CAZyme Information: MGYG000002389_01078

Basic Information

• Species: Latilactobacillus sakei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus sakei
• CAZyme ID: MGYG000002389_01078
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000002389_1|CGC6	41230.64	4.6857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002389	1957804	Isolate	not provided	not provided

• Gene Location: Start: 1044922; End: 1046016 Strand: -

Full Sequence      

MGKLGVSIYPERSTFEKDAAYLDLAHQYGFKRVFTSLLEVSGDQDAVLTNFKRVVDYANQ
LGMQVMIDINPGLFEQLGISYDDLSFFHELGAWGIRLDNGFTGQEEAKMTRNPYDLKIEI
NMSQGTSYVDNIMSFSPKRANLLGCHNFYPHRYSGLGEDFFNQCTAQFAQYNLNTAAFVN
SHEATFGPWPTQDGLPTMEVDRDLAMATQMKHYMLMDNIDDIIVGNAYASEAELKTMQTV
FNAEFPAIMIDVAEDITADERKVLFESLHSYRGDRSEYILRSTMTRVIYKDLPFAAHNTV
DIKRGDILIDNVGYGQYKGETQIALQAMPNDGRVNVVGHIAPDELFLLKYLKPWSSFKLI
PNAQ

Enzyme Prediction     

No EC number prediction in MGYG000002389_01078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	3	359	2e-121	0.9942857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3589	COG3589	8.28e-159	1	360	1	357	Uncharacterized protein [Function unknown].
pfam19200	DUF871_N	2.74e-126	4	237	1	233	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
pfam05913	DUF871	8.46e-52	248	360	3	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SON65259.1	2.03e-273	1	364	1	364
SON73325.1	2.03e-273	1	364	1	364
BAX68299.1	2.03e-273	1	364	1	364
CAI55348.1	2.03e-273	1	364	1	364
ASN12640.1	2.03e-273	1	364	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	3.97e-117	3	360	28	384	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]
2P0O_A	6.29e-27	5	363	6	361	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002389_01078.