CAZyme Information: MGYG000002387_01358

Basic Information

• Species: Lactobacillus paragasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus paragasseri
• CAZyme ID: MGYG000002387_01358
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000002387_1|CGC24	24020.12	8.8115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002387	2129154	Isolate	South Korea	Asia

• Gene Location: Start: 1351195; End: 1351821 Strand: +

Full Sequence      

MPRRRRQKNIQYVIARAFAICFTLVVILSGFLYWRHEVAVNEQLRQAQLEKERALQSKER
FIKVVAPIAQRADKPYGLFPSVTIAQACLESNFGQSELSKKYYNLFGVKGTDPNTSRELT
TSEFVNDHWETVTGRFQVYNSYEESIQAHTRLFVNGTSWNKDQYQHVLAAKDYASQAQAL
ETDGYATDPGYAKKLIDLIKEFNLTQYD

Enzyme Prediction     

No EC number prediction in MGYG000002387_01358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	66	204	1.4e-36	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.73e-60	57	208	42	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	5.54e-37	56	208	318	472	amidase domain-containing protein.
smart00047	LYZ2	4.93e-36	51	208	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	4.05e-29	44	208	139	303	1,4-beta-N-acetylmuramoylhydrolase.
NF038016	sporang_Gsm	1.04e-27	61	208	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ART98595.1	5.31e-150	1	208	1	208
QHC53737.1	5.31e-150	1	208	1	208
QTP21195.1	5.31e-150	1	208	1	208
BBD49149.1	5.31e-150	1	208	1	208
QTD67128.1	2.16e-149	1	208	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.42e-27	59	208	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	6.29e-21	60	208	62	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.44e-17	55	201	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.00e-17	55	201	1	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.55e-16	59	206	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.34e-35	61	208	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	2.62e-27	22	208	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	1.86e-26	22	208	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.53e-26	22	208	30	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	6.68e-20	56	208	178	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994151	0.000137	0.000080	0.000001	0.000001	0.005661

TMHMM  Annotations     

start	end
12	34