CAZyme Information: MGYG000002383_01371

Basic Information

• Species: Lacticaseibacillus zeae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus zeae
• CAZyme ID: MGYG000002383_01371
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839	MGYG000002383_13|CGC2	91364.18	5.0217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002383	3001027	Isolate	Italy	Europe

• Gene Location: Start: 22353; End: 24872 Strand: -

Full Sequence      

MMQKARHNKRSTFLIAGIFSAVTVGLLAPTILEQRVYADSTSTAATDSSTQDFHLTNEHS
NLDANNHVLGESIKSQENSTNRAANARSFAATDSATTQSAQASASTASNVLSFTIGDTTV
PRVDTVDVASYQSGMTQANYNKLKELGVKAVIVKASEGSFYRNPYASSQLAQAQSAGLKV
AAYHYVHFANQSDAISEAKYFADTLDSLGFSKNYPVVADVEDSDVTGNVSDNLNAFWDTL
SARGYSNHVVYTGRYYTYSDAIIKTVGNSKAWIAQYPYTPSANNLWNTGYGAWQFSSSAM
IPGYSSRVDVSIDYRGIFTNTLDPILSSSPLSGVKQIDQTNRKDGIYSAPYNTAADATTQ
NQNGVQYNGDMVQLIQQATTRWSTYVQVKASNGQTFWIDQAALKDPKPDPILAKTSENYY
ARIDQSARSDGLYVGGPYRTVASAYVANTDAAGHNDDLVHVIATERTSWSTFAEVEFNDG
TTYWIDTGALKRVSLYPTLSQQNVSYDAVIDETNRQDGIYESGPYGSSDAALNANANGKQ
YDGKAVHVSVEVRNAWSTYVQVTTAEGTKFWIDKAAIKPITLYSVLSTTDQSYTATIDQS
GRSDGIYSAPYATTLSSYAANGDAQKYNGQTVQVLKTATTAWSTYVLVKTSSGDQFWIDK
MGIQSPYFPTLSQTNVSYDGLIDETGRTDGVYVDGPYNSNAATSTVNGDGVKYNGQPVHV
SVEATNQWSTYAKVTLTDGNSFWIDKIAIKPLPTDTIVESHSVNYRAMIDQSTRTDGVYL
NGPYRTSYQTYAANVDAKKYDGQQGTVKQEVTTTWSTYVQIQLDSGAVIWLDKAGIRSV

Enzyme Prediction     

No EC number prediction in MGYG000002383_01371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	126	303	1.4e-40	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06522	GH25_AtlA-like	3.44e-86	123	314	1	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
pfam01183	Glyco_hydro_25	1.02e-38	126	303	1	179	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	7.23e-31	126	312	3	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06414	GH25_LytC-like	1.90e-25	126	314	4	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd06525	GH25_Lyc-like	7.46e-23	126	310	3	181	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABJ69099.1	0.0	2	838	1	920
QPC22211.1	0.0	2	838	1	920
QPC17734.1	0.0	2	838	1	920
CCK21190.1	0.0	2	838	1	920
AEA55735.1	0.0	2	838	1	920

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	8.46e-15	126	321	23	215	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.92e-14	126	389	23	301	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
5A6S_A	6.78e-11	143	311	39	199	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
2WW5_A	6.78e-09	177	314	321	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.56e-08	177	314	321	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P34020	1.04e-13	133	324	8	194	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P26836	7.39e-12	126	311	12	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	3.94e-08	114	309	73	275	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002342	0.996416	0.000317	0.000441	0.000250	0.000198

TMHMM  Annotations     

start	end
13	32