CAZyme Information: MGYG000002382_01436

Basic Information

• Species: Stenotrophomonas maltophilia_AK
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AK
• CAZyme ID: MGYG000002382_01436
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211	MGYG000002382_50|CGC1	23049.27	10.6468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002382	4489830	Isolate	not provided	not provided

• Gene Location: Start: 44003; End: 44638 Strand: -

Full Sequence      

MLTPTLLAQIMLCPLQRAQRWAEPLNAAMKRFGINTPVRAAYFLAQLGHESLSLSRVEES
LSYSRERLLEVFGRYITPADAAGFVHQPAKLGNRVYAGRNGNGNEASGDGYLFRGRGPLQ
HTGRGNYRRMGQLIGQPLEEQPGLLIEPEIGAMAAAAFWKDNGLNTYADQRDVLAVSRVI
NLGNARSRATPNGMADRTARTTRALAALGAR

Enzyme Prediction     

No EC number prediction in MGYG000002382_01436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	36	193	1.1e-27	0.5454545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.04e-53	20	208	22	204	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	3.44e-05	106	159	102	154	Chitinase class I.
cd00325	chitinase_GH19	0.008	2	159	1	152	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCX45082.1	7.40e-138	1	211	1	211
CCH13798.1	7.90e-133	11	211	1	201
QNG67430.1	1.60e-132	1	211	1	211
QGL70205.1	1.60e-132	1	211	1	211
AIL05948.1	1.31e-131	1	211	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	8.60e-23	16	200	30	214	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	2.17e-21	23	183	23	180	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002382_01436.