CAZyme Information: MGYG000002381_02387

Basic Information

• Species: Stenotrophomonas bentonitica_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas bentonitica_A
• CAZyme ID: MGYG000002381_02387
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000002381_41|CGC1	43066.35	8.6326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002381	4114425	Isolate	not provided	not provided

• Gene Location: Start: 48377; End: 49534 Strand: -

Full Sequence      

MAARPAARVSVRRLAALLWVALPCAAMAQGQDIALRGFQDGINHWQSGHGTDYPRYRPDQ
YRQIADNLVALQRRGGGWAVNQDPQRILDEAARAQVSADQATPGGSFDNRNIYTQVSYLA
EAFARSGEARYRDAAVRGLDFILAEQIPTCGGWPHSVPSRTSYHGHITFADDVTSGVLTT
LRRVQREPVFGFITADQRARVEAAVTAGDACLLRLQVRQDGVPTIWAGQYDRTTLQPAQG
RKFELPALVTDESVGVVRYLMSIPDPSPEVVASVNAAMAWFQAHALTGWRLETFQTTPEQ
FQFHRTTVDRRLVADTDAPLLWGRFHDLRDSSVVLANREGERVATFDQIPRERRTGYHWY
GTWPQALITTEYPRWQQRLAGPGAR

Enzyme Prediction     

No EC number prediction in MGYG000002381_02387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	72	366	2.4e-97	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	2.03e-95	72	368	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.10e-84	72	368	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd02889	SQCY	0.002	113	281	22	178	Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. Bacterial SQCY catalyzes the convertion of squalene to hopene or diplopterol. Eukaryotic OSQCY transforms the 2,3-epoxide of squalene to compounds such as, lanosterol (a metabolic precursor of cholesterol and steroid hormones) in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain. This group also contains SQCY-like archael sequences and some bacterial SQCY's which lack this minor domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOX62466.1	1.26e-289	1	385	1	385
QHB73405.1	7.24e-264	1	385	1	385
AHY60929.1	5.94e-263	1	385	1	385
QIO86373.1	1.10e-233	1	385	1	386
AWH35295.1	2.74e-186	1	382	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	4.67e-42	56	378	78	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	2.03e-38	65	368	37	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	2.89e-37	65	368	37	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.999079	0.000172	0.000158	0.000147	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002381_02387.