CAZyme Information: MGYG000002379_01138

Basic Information

• Species: Lactobacillus acidophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus acidophilus
• CAZyme ID: MGYG000002379_01138
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278	MGYG000002379_8|CGC1	32635.91	9.6569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002379	2009479	Isolate	not provided	not provided

• Gene Location: Start: 47382; End: 48218 Strand: +

Full Sequence      

MNILFCGDANAEDGVLITTLSLLKNSGAKDLHLYILTMEAHSDERKYQPFSKHAADYIRS
LLIEANPKNTLELIDCTDLFLKEPPTANMNTRFTPYAMLRLFADELPQIPDRILYLDDDI
AIRGDITAFYKQNIKGIELVGVLDYWGRFFFHNIKTKRVFDYLNSGVLLLNMKKIKQTGL
FAKVRHMMQTKKMFLPDQSAINKLAVAKRVVPRRYNEQYKLQKDTKIQHFTTSFRFWPYF
HTQTVKPWDVARVHSVLHLHEYDDLLNEYLKIRDNLKK

Enzyme Prediction     

No EC number prediction in MGYG000002379_01138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	248	4.3e-34	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	6.39e-40	1	237	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	2.01e-18	1	278	3	283	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	3.83e-18	2	237	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
PRK15171	PRK15171	5.83e-12	1	226	26	247	lipopolysaccharide 3-alpha-galactosyltransferase.
cd00505	Glyco_transf_8	2.94e-09	1	237	1	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGK93306.1	7.86e-205	1	278	1	278
AVW87732.1	7.86e-205	1	278	1	278
QKQ19939.1	7.86e-205	1	278	1	278
ASX14098.1	7.86e-205	1	278	1	278
ASN46016.1	7.86e-205	1	278	1	278

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27129	2.83e-09	1	226	28	245	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19816	7.32e-08	2	226	29	249	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002379_01138.