CAZyme Information: MGYG000002378_01446

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_01446
• CAZy Family: GT4
• CAZyme Description: 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000002378_36|CGC1	41095.72	9.3639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 240629; End: 241741 Strand: +

Full Sequence      

MKIVHLVPSMESGGVEQVVLELGRGFSAQGVENIVISGGGRMVEQLEKEGSRHILMPIGK
KSLSTFFRVGALRALLQAIRPDILHLHSRVPAWAGYLAWKKLPPEDRPGLITSVHGFYSV
NWYSAIMCRGERIIAVSNCIRDYILRHYPSTPEEHIRIIPNAISPELHHSGYSPSREWLT
GWYMTYPELRDKFTLCLPGRITRLKGQLDMIPIVRDLLAQGIPAHAVIVGEAKKGKEEYK
NEILRKIEQAGLAHAFTWTGHRKDLREILSACSVTLSLTQSPEAFGKSTLEALALGKPVA
GYAHGGVKEQLDIFLPEGNIPVGDTAAITALLARWHAQPPPVPRQIPSPYKMSDMIQAHL
NVYREISPSP

Enzyme Prediction     

No EC number prediction in MGYG000002378_01446.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	311	2.5e-17	0.725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03819	GT4_WavL-like	2.75e-56	3	340	1	323	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03801	GT4_PimA-like	3.17e-39	2	333	1	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	7.40e-35	2	328	1	319	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03811	GT4_GT28_WabH-like	4.20e-34	2	334	1	327	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG0438	RfaB	5.29e-28	1	366	3	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO89885.1	1.88e-272	1	370	1	370
QWP69646.1	1.88e-272	1	370	1	370
QWO94839.1	1.88e-272	1	370	1	370
QWO92307.1	1.88e-272	1	370	1	370
QWO85004.1	1.88e-272	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MI0_A	8.83e-30	3	312	23	329	ChainA, Glycosyltransferase [Rickettsia africae ESF-5]
4XSO_A	7.16e-13	1	312	7	323	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53U18	2.53e-11	13	329	26	365	2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Streptomyces fradiae OX=1906 GN=neoD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_01446.