CAZyme Information: MGYG000002374_01127

Basic Information

• Species: Campylobacter testudinum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter testudinum
• CAZyme ID: MGYG000002374_01127
• CAZy Family: GT66
• CAZyme Description: Undecaprenyl-diphosphooligosaccharide--protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	MGYG000002374_6|CGC1	87955.15	8.7673

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002374	1770849	Isolate	United States	North America

• Gene Location: Start: 63159; End: 65435 Strand: +

Full Sequence      

MKNLGNFFMIFRSNTLFLIILAYIFSVICRFEWIYWASGYAEFFWNNQLMISTNDGYAYA
EGARDMIAGFHQPNDLSFYGTPLSSMTYLLTQITPFSIETIMVYLSVFLGGLVVIPIILM
AREIGEIKAGFIAALLASIANSYYNRTMAGYYDTDMLIISLPIFTFWGIVRLYTKRDLKS
FLIVAFSMLIYSWWYPSSFSLNVAITLFFGLYTIIFDRKNILNYQAILFMILAISGAEYF
IRAILILALFAFIKFKPNLINKKVMIALYAAVLLFFIYFGGLNPIWFQLKFYIFRSVSDS
DGVMFKYFNVNQTIMESGMIDFKFFAQRISGDIFVFLIALIGYALLCFKYRIFLVTLPMI
GLGFLSLKGGLRFTIYAVPMMAFGFGYALSWISKYIKIDKKYRKISLYTVTFFSFLPVIL
LVLLQIYEGIYLDEFKFLFPIFVVGYILFYFKFRREIATMVLFPLSLFALTPSLIHIYEY
KPLTVFMNSEVKVLDRLKTIADPEDYVVAWWDYGYAIRYYSDTKTLIDGGKHLGRDNFAV
SWALSRPFVSSANMARLEVEYTEKAFNQKFNSNLNEMLKDYNASDVNGFLTSLNDQNFTL
PEKTRDIYYYLPDRMMGIFPVVTKFSRLDLVSAKEFRDAFFIVSTSFAQGSDGVVLSEGI
TISNDGTKISFNGKTFRVNSYIETKYDKNMNLEKQIHHIDDNGGFYVIYMVDYGRFLIMD
KEMFDSTYIQLFVLENYEGSDYEPVILDPSAKVYKLKR

Enzyme Prediction     

EC	2.4.99.19

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	17	633	5e-100	0.8773448773448773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02516	STT3	4.73e-46	18	530	9	477	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG1287	Stt3	1.59e-30	16	640	23	634	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam18527	STT3_PglB_C	7.13e-20	640	718	1	79	STT3/PglB C-terminal beta-barrel domain. Asparagine-linked glycosylation is a post-translational modification of proteins containing the conserved sequence motif Asn-X-Ser/Thr. The attachment of oligosaccharides is implicated in diverse processes such as protein folding and quality control, organism development or host-pathogen interactions. The reaction is catalysed by oligosaccharyltransferase (OST), a membrane protein complex located in the endoplasmic reticulum. The central, catalytic enzyme of OST is the STT3 subunit, which has homologues in bacteria and archaea. Structural analysis of a bacterial OST, undecaprenyl-diphosphooligosaccharide protein glycotransferase EC:2.4.99.19 (PglB) protein, revealed two domains: a transmembrane domain and a periplasmic domain. This entry represents the C-terminal periplasmic beta-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVK81608.1	0.0	1	758	1	758
AJB45920.1	0.0	1	758	1	758
AGZ82192.1	0.0	1	758	1	758
ALV65362.1	0.0	1	758	1	758
QMS60509.1	0.0	1	758	1	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCE_A	6.19e-188	15	758	16	712	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
5OGL_A	2.22e-182	15	758	16	712	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
6GXC_A	3.15e-182	15	758	16	712	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	6.00e-51	484	756	9	289	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HTX9	2.44e-201	18	757	17	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
Q0P9C8	9.75e-201	18	757	17	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
B9KDD4	9.21e-187	15	758	16	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1
Q2EMT4	2.23e-06	105	566	163	649	Dolichyl-phosphooligosaccharide-protein glycotransferase OS=Methanococcus voltae OX=2188 GN=aglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999916	0.000086	0.000003	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
13	35
98	120
127	144
154	173
178	195
199	216
228	250
265	287
333	355
370	392
405	427
437	454
461	478