CAZyme Information: MGYG000002369_00898

Basic Information

• Species: Clostridioides difficile
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile
• CAZyme ID: MGYG000002369_00898
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002369_1|CGC7	41542.37	7.3138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002369	4190038	Isolate	United States	North America

• Gene Location: Start: 986954; End: 988027 Strand: +

Full Sequence      

MNKFKLKRSILISLIILIFIFIVYFVSIELKDGSLVNNQYKGKIKSANLSVDYEINQVMK
DIDKLGLNTVNVPIIINVESINSDIMSIDNNSKEKAIKLIKKLNKKGISTILEAYPWVEN
GKLYETDWNPINKKRFFYTWQNAILNELIIDVANPLDVNVLNIGSNFVHLEEYQQNWGEI
IDFVQSKFDGLVTYRTNWWYTKKDDSSSKLFYEQKLNNNFFDKLDFISIAAYFELSNKPV
NTVDELISALHSSTVNNRGQNIKQEIYNLYKAHRKPIFFGELGFSNRESASSQPWNHTPS
KAVNGEEQARCFEAYKKVFENEDWINGFSVFCVGKIDDEKNFYPSKESIKVIKSWYE

Enzyme Prediction     

No EC number prediction in MGYG000002369_00898.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	53	334	2.9e-50	0.8562091503267973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	2.44e-51	42	356	1	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	9.76e-17	163	328	137	267	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB67582.1	2.21e-253	1	357	1	357
AXU56434.1	2.21e-253	1	357	1	357
QPK95695.1	2.21e-253	1	357	1	357
AXB60137.1	2.21e-253	1	357	1	357
AVB49019.1	2.57e-253	1	357	5	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CD6_A	5.85e-13	152	331	137	281	Thestructure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG [Alicyclobacillus acidocaldarius],4CD7_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD7_B The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD8_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManMIm [Alicyclobacillus acidocaldarius]
3CIV_A	6.86e-13	152	331	160	304	Crystalstructure of the endo-beta-1,4-mannanase from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.936007	0.048614	0.006592	0.000239	0.000166	0.008401

TMHMM  Annotations     

start	end
9	28