CAZyme Information: MGYG000002369_00350

Basic Information

• Species: Clostridioides difficile
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile
• CAZyme ID: MGYG000002369_00350
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000002369_1|CGC1	57131.54	5.1065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002369	4190038	Isolate	United States	North America

• Gene Location: Start: 333887; End: 335353 Strand: +

Full Sequence      

MRKFPEGFLWGGATAANQFEGGWNLGGKGWSVSDVAKAHFDADVKDYKSNNEITTKDIEE
GLAHPEDEVNYPKRHGSDFYHHYKEDIALMAEMGFKTYRMSIAWSRIFPNGDDKEPNEEG
LQFYDDVFDELISYGIEPLVTMSHYEPPLNIVLNYDGWYSRQVINMFVRYVETICERYKN
KVKYWLTFNEVDSMIRHPYTTGGLVRDRFKDKNFEEVIFQAMHHQFVASALATKICHEII
PNSKVGCMLTKLTYYPYTCRPEDVLATQQKMRSIYAYSDTQVFGEYPVYLLSYFKNNNIQ
IAKEEHDDEIMKKYPVDFISFSYYMSSCEAADTTGLDITPGNTLLAVKNPYLEMSEWGWQ
IDSIGLRISLIELYDRYRKPLFIVENGLGAKDILTEDKKVHDQYRINYLKEHFKCMLDAI
IEDGVELWGYTSWGCIDLVSESTKQMSKRYGYIYVDADDYGKGTYNRYKKDSFYWYKKVI
ENNSIDFK

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	484	5.7e-140	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	1	486	1	472	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	486	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	486	6	476	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	483	1	472	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	7.75e-179	3	483	5	473	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYD05678.1	0.0	1	488	1	488
AVB55797.1	0.0	1	488	1	488
AVB66589.1	0.0	1	488	1	488
AYD12003.1	0.0	1	488	1	488
AUA35757.1	0.0	1	488	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	4.48e-189	2	483	6	465	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.05e-174	1	483	17	481	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	9.76e-166	5	483	9	475	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.52e-162	1	486	4	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.33e-162	1	486	4	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.63e-186	2	483	6	465	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.08e-180	3	483	6	467	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.59e-170	1	486	1	472	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	5.34e-165	5	483	9	475	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	7.39e-164	1	488	1	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002369_00350.