CAZyme Information: MGYG000002360_01409

Basic Information

• Species: Lactobacillus hominis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus hominis
• CAZyme ID: MGYG000002360_01409
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	MGYG000002360_9|CGC1	23599.83	9.4793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002360	1926186	Isolate	France	Europe

• Gene Location: Start: 35301; End: 35924 Strand: -

Full Sequence      

MPKRSRQNKANLLLLKVFAFAIVFVVLMAGLYYRHQINVQQIQQQELLKQRAMQSRQNFV
KVIAPIAQAEDKPYGILPSVTIAQACLESNYGQSDLAKKYNNLFGVKGTDPNTSQVMTTQ
EFVNGHWETIHGRFQIYDSYQASIHAHTMLFVNGTSWNSKQYQHVLAAKDYRSQAKALEI
DGYATDPGYANKVVSIIEQYNLTQYDN

Enzyme Prediction     

No EC number prediction in MGYG000002360_01409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	64	202	1.4e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.85e-60	55	207	42	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	6.85e-34	49	206	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	1.87e-32	54	207	318	473	amidase domain-containing protein.
NF038016	sporang_Gsm	1.24e-27	56	206	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK06347	PRK06347	1.65e-26	47	207	138	304	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEF36311.1	1.09e-96	1	206	1	208
QGT98238.1	3.11e-96	1	206	1	208
ART98595.1	4.41e-96	1	206	1	208
QHC53737.1	4.41e-96	1	206	1	208
QTP21195.1	4.41e-96	1	206	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.90e-25	56	206	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.50e-17	59	207	63	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.23e-14	53	199	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.28e-14	57	204	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.73e-14	57	204	3	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.91e-39	56	206	48	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	3.12e-24	42	206	48	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	4.24e-24	42	206	48	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	2.89e-23	42	206	48	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	1.61e-17	54	206	178	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.948144	0.002287	0.000759	0.000018	0.000011	0.048803

TMHMM  Annotations     

start	end
12	34