CAZyme Information: MGYG000002359_03060

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_03060
• CAZy Family: GT2
• CAZyme Description: Phthiocerol synthesis polyketide synthase type I PpsE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1488	MGYG000002359_9|CGC1	158745.06	5.5252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 145907; End: 150373 Strand: +

Full Sequence      

MSIPENAIAVVGMAGRFPGAKDVSAFWSNLRRGKESIVTLSEQELRDAGVSDKTLADPAY
VRRAPLLDGIDEFDAGFFGFPPLAAQVLDPQHRLFLQCAWHALEDAGADPARFDGSIGVY
GTSSPSGYLLHNLLSHRDPNAVLAEGLNFDQFSLFLQNDKDFLATRISHAFNLRGPSIAV
QTACSSSLVAVHLACLSLLSGECDMALAGGSSLCIPHRVGYFTSPGSMVSAVGHCRPFDV
RADGTVFGSGVGLVVLKPLAAAIDAGDRIHAVIRGSAINNDGSAKMGYAAPNPAAQADVI
AEAHAVSGIDSSTVSYVECHGTGTPLGDPIEIQGLRAAFEVSQTSRSAPCVLGSVKSNIG
HLEVAAGIAGLIKTILCLKNKALPATLHYTSPNPELRLDQSPFVVQSKYGPWECDGVRRA
GVSSFGVGGTNAHVVLEEAPAEASEVSAHAEPAGPQVILLSAQTAAALGESRTALAAALE
TQDGPRLSDVAYTLARRRKHNVTMAAVVHDREHAATVLRAAEHDNVFVGEAAHDGEHGDR
ADAAPTSDRVVFLFPGQGAQHVGMAKGLYDTEPVFAQHFDTCAAGFRDETGIDLHAEVFD
GTATDLERIDRSQPALFTVEYALAKLVDTFGVRAGAYIGYSTGEYIAATLAGVFDLQTAI
KTVSLRARLMHESPPGAMVAVALGPDDVTQYLPPEVELSAVNDPGNCVVAGPKDQIRALR
QRLTEAGIPVRRVRATHAFHTSAMDPMLGQFQEFLSRQQLRPPRTPLLSNLTGSWMSDQQ
VVDPASWTRQISSPIRFADELDVVLAAPSRILVEVGPGGSLTGSAMRHPKWSTTHRTVRL
MRHPLQDVDDRDTFLRALGELWSAGVEVDWTPRRPAVPHLVSLPGYPFARQRHWVEPNHT
VWAQAPGANNGSPAGTADGSTAATVDAARNGESQTEVTLQRIWSQCLGVSSVDRNANFFD
LGGDSLMAISIAMAAANEGLTITPQDLYEYPTLASLTAAVDASFASSGLAKPPEAQANPA
VPPNVTYFLDRGLRDTGRCRVPLILRLDPKIGLPDIRAVLTAVVNHHDALRLHLVGNDGI
WEQHIAAPAEFTGLSNRSVPNGVAAGSPEERAAVLGILAELLEDQTDPNAPLAAVHIAAA
HGGPHYLCLAIHAMVTDDSSRQILATDIVTAFGQRLAGEEITLEPVSTGWREWSLRCAAL
ATHPAALDTRSYWIENSTKATLWLADALPNAHTAHPPRADELTKLSSTLSVEQTSELDDG
RRRFRRSIQTILLAALGRTIAQTVGEGVVAVELEGEGRSVLRPDVDLRRTVGWFTTYYPV
PLACATGLGALAQLDAVHNTLKSVPHYGIGYGLLRYVYAPTGRVLGAQRTPDIHFRYAGV
IPELPSGDAPVQFDSDMTLPVREPIPGMGHAIELRVYRFGGSLHLDWWYDTRRIPAATAE
ALERTFPLALSALIQEAIAAEHTEHDDSEIVGEPEAGALVDLSSMDAG

Enzyme Prediction     

No EC number prediction in MGYG000002359_03060.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3321	PksD	0.0	4	1024	2	1008	Acyl transferase domain in polyketide synthase (PKS) enzymes [Secondary metabolites biosynthesis, transport and catabolism].
cd00833	PKS	0.0	8	436	3	421	polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits.
smart00825	PKS_KS	5.63e-140	8	438	1	298	Beta-ketoacyl synthase. The structure of beta-ketoacyl synthase is similar to that of the thiolase family and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains.
smart00827	PKS_AT	1.97e-93	553	842	1	296	Acyl transferase domain in polyketide synthase (PKS) enzymes.
TIGR02813	omega_3_PfaA	8.48e-93	8	822	9	873	polyketide-type polyunsaturated fatty acid synthase PfaA. Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ00088.1	3.21e-237	8	1088	1214	2316
BAZ75991.1	3.21e-237	8	1088	1214	2316
BAY30132.1	2.85e-236	8	1088	1216	2318
BAY90071.1	1.52e-234	8	1088	1213	2307
AFY93865.1	1.48e-193	3	1026	956	2003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MZ0_A	3.00e-154	5	896	38	937	ChainA, CurL [Moorena producens 3L],4MZ0_B Chain B, CurL [Moorena producens 3L]
4WKY_A	6.78e-154	2	531	3	523	Streptomcyesalbus JA3453 oxazolomycin ketosynthase domain OzmN KS2 [Streptomyces albus],4WKY_B Streptomcyes albus JA3453 oxazolomycin ketosynthase domain OzmN KS2 [Streptomyces albus]
7VEE_A	7.44e-144	5	896	20	913	ChainA, Polyketide synthase [Streptomyces graminofaciens],7VEF_A Chain A, Polyketide synthase [Streptomyces graminofaciens]
4OQJ_A	5.02e-142	3	634	18	615	Streptomcyesalbus JA3453 oxazolomycin ketosynthase domain OzmQ KS1 [Streptomyces albus]
7S6B_A	5.81e-133	5	901	57	938	ChainA, Polyketide synthase [Streptomyces lasalocidi],7S6B_B Chain B, Polyketide synthase [Streptomyces lasalocidi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WQE1	0.0	1	1488	1	1488	Phenolphthiocerol/phthiocerol polyketide synthase subunit E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsE PE=1 SV=1
P9WQE0	0.0	1	1488	1	1488	Phenolphthiocerol/phthiocerol polyketide synthase subunit E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=ppsE PE=3 SV=1
Q7TXL6	0.0	1	1488	1	1488	Phenolphthiocerol/phthiocerol polyketide synthase subunit E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsE PE=1 SV=1
B2HIL7	1.19e-136	8	907	44	927	Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) OX=216594 GN=pks15/1 PE=1 SV=1
I6XD69	4.08e-135	5	895	2056	2921	Mycoketide-CoA synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999958	0.000053	0.000023	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002359_03060.