CAZyme Information: MGYG000002359_01070

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_01070
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor RpfB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000002359_2|CGC1	38078.4	5.2191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 33884; End: 34972 Strand: +

Full Sequence      

MLRLVVGALLLVLAFAGGYAVAACKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRD
DLYPAAGVQVHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMTDTAPAAA
SRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAPNVAGLLSAAGVPLLQSDHVVPAA
TAPIVEGMQIQVTRNRIKKVTERLPLPPNARRVEDPEMNMSREVVEDPGVPGTQDVTFAV
AEVNGVETGRLPVANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAIN
TGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLRQGWGAWPVCAARAG
AR

Enzyme Prediction     

No EC number prediction in MGYG000002359_01070.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	2.51e-133	15	302	28	309	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam06737	Transglycosylas	2.93e-44	281	355	1	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	1.93e-32	283	355	1	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam07501	G5	3.58e-19	198	271	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
cd00442	Lyz-like	8.43e-09	284	340	1	56	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIH39880.1	1.88e-252	1	362	1	362
ALB18154.1	1.88e-252	1	362	1	362
AMC41067.1	1.88e-252	1	362	1	362
AHJ41709.1	1.88e-252	1	362	1	362
AIH36547.1	1.88e-252	1	362	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E27_A	1.60e-174	115	362	1	248	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
3EO5_A	1.58e-118	194	362	3	171	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	6.20e-73	255	362	1	108	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4EMN_A	3.86e-53	282	362	1	81	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4KL7_A	2.10e-52	283	362	1	80	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
H8EZH5	3.77e-253	1	362	1	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
P9WG28	3.77e-253	1	362	1	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	3.77e-253	1	362	1	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
A0R3E0	4.51e-192	1	362	1	362	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
Q6M6N7	2.01e-57	2	362	20	374	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.146165	0.220085	0.632417	0.000409	0.000273	0.000651

TMHMM  Annotations     

start	end
7	29