CAZyme Information: MGYG000002356_04916

Basic Information

• Species: Bacillus_A wiedmannii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A wiedmannii
• CAZyme ID: MGYG000002356_04916
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869	MGYG000002356_47|CGC1	98605.03	8.4245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002356	5414628	Isolate	Netherlands	Europe

• Gene Location: Start: 68403; End: 71012 Strand: +

Full Sequence      

MGNNSKYKTRKILAATATVTMLATAMISTTDIIAEETKQQNKISTSLQEEKSVKLENRSY
TVPGKGDVEVLKQQERKSMAFSPYEPTGLYAKPNEQITINVEGNENIQAYIGTYSYDASW
REDSKIKSFTLKPGINTIQSPNGGMIYFYNKQQGGTIRTTVTTGGTTTPFFELGKHTKQD
LIDMLNQNPNAHAVELKGERVLITASPARVKKYLLGSNTDPVQLLKKMDEATRIQDKVAG
LSEEQADKHYIHYVEENHSPDYYMYATSYRTAYVGDAIQYVLDINKFIKDGWGPWHEAGH
LRQQAPWKFYNMTEVQNNIYSLSVEKAFTSNQSFRLQQEGAYTKAFQYLEQPNKNYDEVS
DVFVKLVMLWQLQLAYGEDFYPKLHQLYRDMPSNELPQTDENKKQLFMISASKVAKQNLM
PFFEKWGLRPNNDTIQKVAALGYPVLTAEIWKGTDSNPIKPDVPNANNILEGSQFAWSMK
GISDFEFAKINFNKSAEEMQVDLKAGIPHHYFNETYASIKVQNASGKVVYNKDIYGNKQQ
NAESQKVPVKVGDYIELTHQEGVHRATLTNVDSSKQESFGKKAMYEVTKEGLKKVEKIPE
VTILDGNQFAWSMKGISDFEFAKINFNKSTEEMHIDLKAGVPHHYFNETYASIKVQNASG
KVVYNKDIYGNKQQNAESQKVPVKVGDYIELTHQEGVHRATLTNVDSSKQESFGKKAMYE
VTKEGLKKVEKMPETTVLDGNQFSWSLKGYSDREIAKVNYNRVTEKIQVNLEAGVPHSYF
NNTYASIKVQNSSGSVVYNKEIVGNRQQTAESQTVPVKVGDYIEFTHIEGEAVNEKTRAK
LTNLENNKQEYIGKKRIYQVTSTGLNKID

Enzyme Prediction     

No EC number prediction in MGYG000002356_04916.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	2.03e-53	169	427	6	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
pfam03272	Mucin_bdg	1.88e-22	613	726	2	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	2.72e-22	479	592	2	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	9.12e-20	747	865	2	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam17291	M60-like_N	6.60e-12	82	153	18	96	N-terminal domain of M60-like peptidases. This accessory domain has a jelly roll topology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWH61013.1	0.0	1	598	1	598
AIW85129.1	0.0	1	598	1	598
QWH69691.1	0.0	1	598	1	598
ANS49177.1	0.0	1	598	1	596
AHX21874.1	0.0	1	598	1	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EV7_A	1.13e-122	49	460	8	412	Thecrystal structure of a functionally unknown conserved protein mutant from Bacillus anthracis str. Ames [Bacillus anthracis str. Ames]
4FCA_A	1.65e-117	49	460	8	412	Thecrystal structure of a functionally unknown conserved protein from Bacillus anthracis str. Ames. [Bacillus anthracis str. Ames]
5KD5_A	3.78e-16	86	450	59	437	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
5KD2_A	9.81e-16	86	450	107	485	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6XSX_A	7.27e-08	70	455	34	436	ChainA, ZmpA Glycopeptidase [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6QR59	4.34e-10	143	441	602	894	TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1
Q6P6V7	8.74e-09	87	441	538	894	TRPM8 channel-associated factor 3 OS=Rattus norvegicus OX=10116 GN=Tcaf3 PE=2 SV=1
Q5XHI4	3.41e-08	87	441	529	885	TRPM8 channel-associated factor homolog OS=Xenopus laevis OX=8355 GN=tcaf PE=2 SV=1
A6QLU7	6.07e-06	292	441	752	902	TRPM8 channel-associated factor 2 OS=Bos taurus OX=9913 GN=TCAF2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000981	0.997298	0.001043	0.000273	0.000207	0.000170

TMHMM  Annotations     

start	end
12	34