CAZyme Information: MGYG000002354_01315

Basic Information

• Species: Moellerella wisconsensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Moellerella; Moellerella wisconsensis
• CAZyme ID: MGYG000002354_01315
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	MGYG000002354_14|CGC2	55750.87	4.8768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002354	3303166	Isolate	not provided	not provided

• Gene Location: Start: 51579; End: 53048 Strand: +

Full Sequence      

MNKWLANTQLVLAKQQVIDNDPFRPSYHIAPKLGLLNDPNGLIQFNGQYHVFYQWNPFAC
DHSQKCWGHYISDDLVHWREVAPAITPDASYDANGCYSGSAFVHHDELYLFYTGNLKYGV
DQQQRASRQCLAKSKNGIDFEKIGIVIDGEPEGYTAHFRDPKIWREGEQWLAVIGAQTEK
LHGQVLLYRSENLTEWHCLGPITGSGIYPFDDFGYMWECPDLFRLGEQWVMLASPQGIEP
QGMKYQNIYQSGYLLGQLSLAPAQFDTQHFEELDRGFEFYAPQSFLDNQGRRIMLAWMGL
PEENVQPTVEYGWLHQMTLPRELSIRDGKLYQTPVAELVALRQSHIHYQSVDFSGILMLE
GVKGRCYELRAEFSDLTSPLSLKLRSNGADQYTLLHFDPENLVITLDRDHAGAGLGGIRQ
CKLAQSNSLELVIFADNSSLEIFINQGEAVFSARIFPEMTSTEICFESTTPCHINTVDYF
ELKTDGVIR

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	28	334	4.4e-102	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	21	457	11	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.30e-179	20	471	25	473	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	4.26e-167	34	327	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.50e-151	28	447	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.66e-140	28	334	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ38516.1	1.55e-156	18	466	24	466
QNU38750.1	1.55e-156	18	466	24	466
QAA34826.1	4.20e-156	2	468	4	475
ALF09147.1	1.38e-154	15	466	21	465
ANZ29229.1	1.38e-154	15	466	21	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	8.72e-107	23	483	25	486	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	8.16e-83	12	458	37	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.25e-81	12	458	37	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	1.36e-76	4	470	15	476	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	1.17e-67	23	458	2	407	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.65e-142	14	475	19	472	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P37075	3.06e-124	9	484	12	462	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P27217	2.29e-115	9	471	12	452	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
A1STJ9	8.81e-112	23	467	95	525	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
F8DVG5	1.16e-106	25	461	30	477	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002354_01315.