CAZyme Information: MGYG000002353_02663

Basic Information

• Species: Enterococcus_B faecium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B faecium
• CAZyme ID: MGYG000002353_02663
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002353_1|CGC39	55463.98	5.9601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002353	3157885	Isolate	Netherlands	Europe

• Gene Location: Start: 2723862; End: 2725286 Strand: +

Full Sequence      

MTTMKKLTFPDDFWWGSAWSAEQAEGKGETGKAETIWDRWFKEQPYRFYQRIDSSITTDH
IHQYKEDIELMKKTGHNSFRVSISWARMFPNGGTGKVNPKAISFYRKLFSEMNNNGIKVF
ANLYHFDMPATLQDKGGWESREVVDAYVHYAETCFKEFGDLVCHWFTFNEPLGPILGTYL
EDFHYPNLIDFKRGAQAAFFTILAHAKAIQVFKELALPSKIGVILNLSPTFPRSQNPADV
KAAEIADLFYTRSFLDPMVKGNFSKKLILLLQEYNQLPEDYTKEDLVCIYENTAQILGLN
YYEPRRVKSRSSMVDTSSPFLPEWFFEPHIMPGRRMNEYRGWEIYEKGIYDLCMDIKNHY
GNIEAFISENGMGVADEERFMDDTGQIIDDYRIEYIKDHLAYLWKAINEGCNIKGYHLWT
FIDCWSWINAYKNRYGLVSLDLTTQKRTIKKSGEFYKQLSDTNGFRYDVDLLVE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.85	3.2.1.86

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	464	6.7e-137	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	6	464	1	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.13e-136	8	465	4	453	Glycosyl hydrolase family 1.
TIGR03356	BGL	3.47e-134	10	456	1	426	beta-galactosidase.
PRK13511	PRK13511	1.10e-117	4	462	2	465	6-phospho-beta-galactosidase; Provisional
PRK09852	PRK09852	2.18e-63	8	464	3	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ51866.1	0.0	1	474	1	474
QMX43506.1	0.0	1	474	1	474
QMV90447.1	0.0	1	474	1	474
QDZ48744.1	0.0	1	474	1	474
QTO57735.1	0.0	1	474	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	4.41e-145	7	463	1	459	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	2.60e-144	7	463	2	460	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	9.00e-131	5	465	16	477	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	9.00e-131	5	465	16	477	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	3.56e-120	2	468	4	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	9.12e-201	1	465	1	465	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	6.58e-106	4	465	1	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q08638	2.07e-91	4	464	1	443	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B9K7M5	4.77e-89	4	464	1	441	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P67767	5.57e-88	8	462	4	466	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002353_02663.