CAZyme Information: MGYG000002349_01174

Basic Information

• Species: Streptococcus agalactiae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus agalactiae
• CAZyme ID: MGYG000002349_01174
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	MGYG000002349_49|CGC1	33524.82	10.312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002349	2041264	Isolate	United States	North America

• Gene Location: Start: 794; End: 1681 Strand: -

Full Sequence      

MAHTPTSHRKPRKRSPWLAIASVFFLLIALIGIFLFFNNRSKQEIKTKTNASSHRKIVTS
IKKKKWVKQKTPVKIPILMYHAVHVMDPSEAASANLIVAPDIFESHIKRLKKEGYYFLAP
NEAYRALNENALPEKKVIWITFDDGNADFYTKAYPILKKYKVKATNNIITGFVQEGRESN
LNVQQMLEMKQNGMSFQGHTVTHPNLSLLTPELQTQEMTLSKLFLDQKLSQDTLAIAYPS
GRYNPTTLDIASQYYKLGLTTNEGVATKDNGLLSLNRVRILPTTSDDDLIKTINQ

Enzyme Prediction     

No EC number prediction in MGYG000002349_01174.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	133	253	9.9e-26	0.8692307692307693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	6.88e-52	138	280	2	154	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	2.10e-35	100	278	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.20e-33	133	260	4	122	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10970	CE4_DAC_u1_6s	4.23e-33	136	292	2	156	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	3.20e-28	133	289	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	3.33e-50	66	285	56	267
AUP39995.1	1.54e-32	79	136	1	58
AUP38274.1	1.54e-32	79	136	1	58
AUP26449.1	1.54e-32	79	136	1	58
AUP41724.1	1.54e-32	79	136	1	58

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	2.60e-100	71	293	5	228	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
6GO1_A	8.97e-16	75	293	100	317	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
4WCJ_A	1.59e-07	77	250	39	218	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4U10_A	7.93e-06	77	164	6	95	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	2.84e-49	66	285	56	267	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6GDD6	8.36e-17	95	287	74	274	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaB PE=3 SV=1
Q6G606	1.15e-16	95	287	74	274	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	1.15e-16	95	287	74	274	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	1.15e-16	95	287	74	274	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37