CAZyme Information: MGYG000002349_01066

Basic Information

• Species: Streptococcus agalactiae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus agalactiae
• CAZyme ID: MGYG000002349_01066
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179	MGYG000002349_38|CGC1	19092.04	7.0079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002349	2041264	Isolate	United States	North America

• Gene Location: Start: 26293; End: 26832 Strand: +

Full Sequence      

MSITSVKKSKPFKLGVAGLLVGASLALPLSVSAASYTVKSGDTLSAIAKNHKTTVQELVS
LNSISNADVISIGDVLKLDNSTASQAEAKSQPTIENSMNSSSNLSSSDSAAKEEIARRES
NGSYTAQNGQYYGRYQLSQSYLNGDLSPENQEKVADNYVVSRYGSWSAALSFWNSNGWY

Enzyme Prediction     

No EC number prediction in MGYG000002349_01066.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	7.49e-14	35	78	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	8.66e-14	36	78	2	44	Lysin motif.
pfam01476	LysM	7.37e-13	36	78	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK10783	mltD	7.88e-10	24	94	334	403	membrane-bound lytic murein transglycosylase D; Provisional
COG1388	LysM	8.54e-06	21	91	54	123	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY67682.1	9.70e-116	1	179	1	179
AQY27335.1	9.70e-116	1	179	1	179
QET54438.1	9.70e-116	1	179	1	179
QET34931.1	9.70e-116	1	179	1	179
AKU04567.1	9.70e-116	1	179	1	179

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GHI8	1.63e-06	36	104	177	245	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lytN PE=3 SV=2
Q5HGI5	7.41e-06	36	104	177	245	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain COL) OX=93062 GN=lytN PE=3 SV=1
Q6G9W6	7.41e-06	36	104	177	245	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=lytN PE=3 SV=2
Q7A123	7.41e-06	36	104	177	245	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MW2) OX=196620 GN=lytN PE=3 SV=2
Q7A5Y8	7.41e-06	36	104	177	245	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain N315) OX=158879 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999001	0.000171	0.000183	0.000172	0.000149

TMHMM  Annotations     

start	end
12	34