CAZyme Information: MGYG000002346_01540

Basic Information

• Species: Acinetobacter pittii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter pittii
• CAZyme ID: MGYG000002346_01540
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1444		157174.04	7.5535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002346	3962855	Isolate	United States	North America

• Gene Location: Start: 18521; End: 22855 Strand: +

Full Sequence      

MAQESRLVIVIDSQNAERNARNLGNELVSIERKGEFASKSMDSLSVATRALAGHMAGLLT
VGSAISKMDTYTGLQNRLKLVTNNQAELNKATEDTFRIAQKTYSAWDSVLQVYQRFSDNA
KTLNLTMDDTARLTETVSKAVAISGASAEAADAALVQFGQALASGTLRGEELNSVMEQTP
ALAKAIAKGMGITVGELRSVAAEGKITSQEIVKALRNVESDVDALFAKTDITIGQSLTLL
NNEITKFVGEAGKGSGAAQVLAGSVQTLASNLDLIADGALVVGIGYITRAILIKSAAIKE
GMASTLASRQASVLNAQAEYAEATAALNAAKAHLANVRATNAETQAKFGATAAATRYAQA
QEAVTAATNAQTAAQTRLSAASSLVGSIGSRALGLIGGPIGAITLGVSALAATYTYFKGK
AEEANRTLAEQAEVANRTAEELKGLKGEAKTKAINDLTTAFKAQNEELKKTEMAVGSALI
DIQNYGKGNVELTRISNEARLGTISYKEAMEQLAKQKLPPSLRDALKEQIDKYNEAYEKA
DKTKTAIKLFGIEVTLTGNKAQNAAIEQQKHADAIKNTKQAADEAQKSLQKLYADKLWDT
QFVEIVMKKGFSESQANDLLKLYKDSLAKGLKAADREAMKALTDTWKAEESIKAITDART
DSIREQNKELKNQQKVLSVNAKVLANASKFGFADLESKYKLPSGTLSAIHMIESKGNAKA
YNKETGATGGFQFLEGTAKQYGVKDRTDLAQSAEGAAKYMSYLLKLFKGDLEKAVRAYHA
GEGNVMKGKGIGKNNNQYWKDYQSYMAGINGYSAGDISSKDFDKLIQDTTKMAEEQAKLR
LQLENEVANQVTKIRNDLAKKLEDVDKANFSPERKAEIKAELQARADNDIAIAEQATKTK
LDSFRDYTKTEEQILKDSYAKRQFEAEHDLDLTNDQRKEAVDLLAQQLKQELGLMQLAQE
QRLFQARLSLLSETQAMQERYRLEREEILKNTKLSIEERQKLIALSKANQDKETRDKVNN
AVQNWGGIQADMNGAGEFFRQDQERFSRLNAANDLADSQFAATDLNEQNSLDGLNAQFEA
GLIKQQDYENQKTAIIQAAQDQRNQIATEYAKNAQDIEDKYQQDRLNTQIAFGGQMMGSL
TSMFGSMFGEQSKAYKIMFAADKAYAIAAAGIAIQQNIAAASKAGFPLNIPLIAGAVAQG
ASIIANIRAIKDQGFAEGGYTGRGGKYQPAGIVHKGEVVWSQEDIKRWGGVGLVEKMRKS
ANPEAFLNNNASADSVMRRAMMSSNAYIESQKQADIFNQSVQDTQIIYKVNRDTPKLASS
ANSDLFHDGKVYFSSNGLVQNRSNLDDVQDFTLGRISRPQAEMMPSIEPSTPTINFKIEV
INQVSGATVEAEQLDEQTVRIIVTDELDKQLPRKVPKLVSDQIGNPNSTISRSLTENTTA
RRNR

Enzyme Prediction     

No EC number prediction in MGYG000002346_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	705	808	2e-17	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02675	tape_meas_nterm	3.03e-18	137	211	1	75	tape measure domain. Proteins containing this domain are strictly bacterial, including bacteriophage and prophage regions of bacterial genomes. Most members are 800 to 1800 amino acids long, making them among the longest predicted proteins of their respective phage genomes, where they are encoded in tail protein regions. This roughly 80-residue domain described here usually begins between residue 100 and 250. Many members are known or predicted to act as phage tail tape measure proteins, a minor tail component that regulates tail length.
pfam01464	SLT	2.85e-16	696	803	5	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	4.04e-16	706	792	4	92	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16894	MltD-like	1.84e-15	698	804	3	110	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13403	MLTF-like	2.73e-12	713	801	22	118	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUT35001.1	0.0	1	1444	1	1444
QEA26080.1	0.0	1	1444	1	1444
QEI28782.1	0.0	1	1444	1	1444
BBU18817.1	0.0	1	1444	1	1444
AYY18618.1	0.0	1	1444	1	1444

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	6.28e-10	697	819	1431	1547	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	6.28e-10	697	819	1431	1547	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	1.01e-07	698	791	70	162	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64330	3.73e-06	1214	1259	715	759	Tape measure protein OS=Escherichia phage N15 OX=40631 GN=gene 16 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002346_01540.