CAZyme Information: MGYG000002346_00569

Basic Information

• Species: Acinetobacter pittii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter pittii
• CAZyme ID: MGYG000002346_00569
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002346_6|CGC1	39242.66	9.3593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002346	3962855	Isolate	United States	North America

• Gene Location: Start: 4790; End: 5887 Strand: +

Full Sequence      

MTDSQQSKPKHVMMMAAGTGGHVFPALAVAKQLQQQGCQVSWLATPTGMENRLLKDQNIP
IYQIDIQGVRGNGLVRKVAAPFKILKATFSAMRYMKQLKVDAVAGFGGYVAGPGGLAARL
LGIPVLIHEQNAVAGFTNAQLSRVAKVVCEAFPNTFPAGGKVVTTGNPVRREITDILSPK
WRYDEREQAGKPLNILIVGGSLGAKALNERLPPALKQLQVPLNIFHQCGQQQVEATQALY
ADAPANLTVHVLPFIEDMAKAYSEADLIICRAGALTVTEVATAGVAAVFVPLPIAVDDHQ
TANAKFLVDVGAAKICQQSTMTPDVLNELFTSLMNRQLLTEMAVKARQHAQPNATQHVVD
LIQKM

Enzyme Prediction     

No EC number prediction in MGYG000002346_00569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	195	354	2.6e-51	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.46e-165	9	365	1	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.19e-137	11	361	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	3.18e-124	10	362	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	5.82e-124	12	364	3	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	1.95e-44	12	148	1	137	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMO39378.1	4.18e-262	1	365	1	365
QOW99435.1	4.18e-262	1	365	1	365
BBU16624.1	4.18e-262	1	365	1	365
ADY83389.1	1.70e-261	1	365	1	365
BBQ47153.1	1.70e-261	1	365	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	3.69e-255	1	365	1	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.18e-107	11	360	4	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	4.51e-84	10	365	7	353	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7ICE5	8.59e-256	1	365	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acinetobacter baumannii (strain AB0057) OX=480119 GN=murG PE=3 SV=1
B7GV73	8.59e-256	1	365	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acinetobacter baumannii (strain AB307-0294) OX=557600 GN=murG PE=3 SV=1
B0V9F5	8.59e-256	1	365	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acinetobacter baumannii (strain AYE) OX=509173 GN=murG PE=3 SV=1
A3M9Y1	2.02e-254	1	365	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) OX=400667 GN=murG PE=3 SV=2
B0VNZ9	2.87e-254	1	365	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acinetobacter baumannii (strain SDF) OX=509170 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002346_00569.