CAZyme Information: MGYG000002345_00434

Basic Information

• Species: Acinetobacter nosocomialis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter nosocomialis
• CAZyme ID: MGYG000002345_00434
• CAZy Family: CE14
• CAZyme Description: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264	MGYG000002345_1|CGC4	29368.3	5.9838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002345	4020363	Isolate	United States	North America

• Gene Location: Start: 472930; End: 473724 Strand: +

Full Sequence      

MGTLTHPLVEDRVISGEGTPKFKWLEAFKTHPLDGLNLQLFRSKRVVIVAPHPDDEVLGC
GGLMQQLVKENCHLVIVAVSNGTQSHPHSTKYSPDQLNELRPQETFAALNSLGVSDHSER
IALNLTDGQIHSQAHLLNQALSQIVQPEDILICSYAFDGHPDHEAVGKTVQAFATVHQLV
CVHVLIWAWHWAEPLDPRIDWSKAQAYALTENQLNKKVQAVMQFKTQIEADESTGNSAVL
SSSAISRLLMPYEVYLSDSFSYVF

Enzyme Prediction     

No EC number prediction in MGYG000002345_00434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	48	143	5.2e-16	0.7419354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02585	PIG-L	1.51e-22	48	168	1	122	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.
COG2120	LmbE	6.68e-22	43	232	10	199	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
TIGR04001	thiol_BshB1	1.29e-10	50	170	8	118	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
PRK02122	PRK02122	1.86e-05	39	78	365	403	glucosamine-6-phosphate deaminase-like protein; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDE98039.1	1.43e-20	7	257	4	232
QDW16445.1	1.62e-19	17	255	8	260
QGY91342.1	2.19e-19	17	255	8	260
QCY44339.1	4.02e-19	17	255	8	260
ACS29674.1	4.02e-19	17	255	9	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UAN_A	4.67e-06	46	177	4	123	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6W733	5.50e-06	39	117	53	134	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=mshB PE=3 SV=1
D2B0T1	8.49e-06	43	117	3	83	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) OX=479432 GN=mshB PE=3 SV=1
D2PN56	8.52e-06	43	117	6	86	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=mshB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002345_00434.