CAZyme Information: MGYG000002339_00080

Basic Information

• Species: Lacticaseibacillus saniviri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus saniviri
• CAZyme ID: MGYG000002339_00080
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000002339_1|CGC1	55603.19	4.7421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002339	2435520	Isolate	not provided	not provided

• Gene Location: Start: 84851; End: 86311 Strand: -

Full Sequence      

MKQPFLWGGAISANQTEGNYLADGKGPSNFDQLPLDDRRLKPVYLDDPNNIFNTEEADYH
PSHNGIDFYHTYADDIALLEELGVNSFRFSISWPRLFATGEETTANPAGLAYYHDLFDRL
KQAHIEPIVTLSHFELPLQLVTNYGGWASRHTMDMYVRYAEFVMNEFKDDVRYWIPFNEM
NMIMHIPFIGGGLTFTKQDNMLQKEYQAAHHQLLANAHVVAIGKRINPDFQFGCMLAAGR
TYPYTPNPKDVWAANLSDRTALLFSDVQVRGHYPAYFDALCRKNHFTIDMAPGDLDLLAQ
NTVDFVSFSYYSSACSAADTDALDTIATNGFTTLKNPYLENTNSVWQVDPLGLRITLNQL
YDRYEKPMFIVENGIGTTDDQLVDGHVHDPYRIKYLSDHFDQMQLAQEEDGIPLIGYMMW
GIIDLVSVSEGKMSKRYGVIYVDRDDHGQGSNQRIRKDSYYWYQDYLTQHINQGGYSDEQ
KLSTIG

Enzyme Prediction     

No EC number prediction in MGYG000002339_00080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	469	2.2e-136	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	3	464	6	463	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	465	8	448	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	1.59e-180	3	464	8	467	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	2.13e-162	1	465	4	467	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.05e-148	1	470	6	473	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB28271.1	9.69e-244	1	471	1	471
QNN72044.1	3.01e-208	1	463	3	464
AIQ22962.1	6.21e-208	1	463	3	463
AWZ44910.1	2.80e-207	1	464	3	465
ALS01765.1	3.47e-206	5	465	7	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.80e-158	5	463	12	458	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	5.19e-141	5	467	24	478	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	7.92e-133	1	467	8	472	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	1.54e-130	5	464	15	470	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	1.74e-126	1	467	7	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	1.35e-158	3	463	6	462	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.31e-157	5	464	12	459	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.00e-138	1	467	4	472	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	2.34e-138	5	467	11	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P26206	1.65e-136	5	470	9	459	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000023	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002339_00080.