CAZyme Information: MGYG000002338_01959

Basic Information

• Species: Staphylococcus haemolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus
• CAZyme ID: MGYG000002338_01959
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000002338_55|CGC1	39586.43	6.9978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002338	2548117	Isolate	Russia	Europe

• Gene Location: Start: 693; End: 1760 Strand: -

Full Sequence      

MSKIAFTGGGTVGHVSVNLSLIPTATDKGHDAFYIGSKTGIEREMIESQLPNIEYYPISS
GKLRRYLSVDNAKDVFKVLKGVIDARKVLKREKPDLLFSKGGFVSVPVVIAARSLNIPTI
IHESDLTPGLANKISLKFAKKIYTTFEDTLKYLPKDKADFVGATIRQDLKEGNQSRGYQL
TGFDASKKVLLVMGGSLGSKKLNQAIRENLEALLQDYQIIHLTGHGLVDSSIDAKGYVQY
EFVKEELTDLLAITDTVVSRAGSNAIYEFLTLRIPMLLIPLGLDQSRGDQIDNAENFESK
GYGRTIPEDQLTQVKLLEQLKEIENDRESIIKQMETYRESYTKEDLFNKILKDAL

Enzyme Prediction     

No EC number prediction in MGYG000002338_01959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	190	339	3.1e-34	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	5.03e-132	1	355	1	352	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
PRK12446	PRK12446	3.17e-129	1	338	1	337	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
COG0707	MurG	1.22e-110	3	354	2	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	4.51e-103	3	328	1	326	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	2.34e-82	2	345	1	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJI69438.1	8.60e-250	1	355	1	355
AYX82959.1	8.60e-250	1	355	1	355
BAE04797.1	8.60e-250	1	355	1	355
QFU26736.1	8.60e-250	1	355	1	355
AKC76234.1	8.60e-250	1	355	1	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.01e-23	3	323	4	321	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.72e-22	10	281	18	292	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	3.19e-22	3	312	8	311	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L6C8	1.72e-250	1	355	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=murG PE=3 SV=1
Q8CMM3	1.24e-216	1	355	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=murG PE=3 SV=1
Q5HPC0	1.24e-216	1	355	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=murG PE=3 SV=1
P65481	1.66e-200	1	355	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=murG PE=3 SV=1
P65482	1.66e-200	1	355	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=murG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002338_01959.