CAZyme Information: MGYG000002338_01955

Basic Information

• Species: Staphylococcus haemolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus
• CAZyme ID: MGYG000002338_01955
• CAZy Family: GH73
• CAZyme Description: Bifunctional autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000002338_54|CGC1	76359.43	9.2311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002338	2548117	Isolate	Russia	Europe

• Gene Location: Start: 11359; End: 13476 Strand: +

Full Sequence      

MKKKFNLKFPSMIAITLFGAAFTSQHAHAAEANQNSNNTNNVIDDQQNIENAEQAKKEVT
NSAQNVSGVQTYQNPSDVKASVATVSKTYDAKLDNLATTQQTSQDQQSTQNQSTANTSAT
NSNSELAKVQDNEQEVSTSNKSDQTTNINNTHSNTDANKQTLQASKNALSSSQVQSNDDT
SANSNQNTTQYVNNQIDESSSNSQQENSLTSSNKNQLNSSSVTPSQSNQVAQSNNQIESK
QSSDKKVSTYSNNDNNATQVNVDQAKTSQEANTKNASASKTTQTSTSNSTQSGYSGFRSV
GGKGGPATSVKTVKRYAAKATTSSLPKYKPQVSSSINNYIRSNNLQAPKIEENYSSYFPK
YGYRNGVGKPEGIVVHDTANDNSTIDGEINYMKNNYNSAFVHAFVDGNRIIETAPTDYLS
WGAGPNANGRFINVEIVHTHDYASFAKSMNNYADYAATQLQYYGLTPNSAENDGQGTVWT
HYAISRFLGGTDHSDPHAYLQSHNYTYNELYDLINEKYLIKTGQVAPWGTTSSSSSSSNT
NKGGSSNSGSTTTSPKLTVKSNSGLAQIKTDNSGVYTTVYDDKGKATNQVHNTLSVTKSA
TLGKDKYYLVSDYNSGKVYGWVKQGETVYNTVKSPVKVNQSYNIKSGATLYTVPWGNYNQ
VAGTVSKSNTAPFKATKSQQVGKATYLYGSLNGKMDGLAKHFYLI

Enzyme Prediction     

EC	3.2.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5632	CwlA	8.34e-52	354	666	1	300	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].
smart00644	Ami_2	8.26e-27	368	496	1	126	Ami_2 domain.
cd06583	PGRP	1.41e-23	369	499	1	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	8.83e-16	369	497	1	120	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
PRK08581	PRK08581	7.51e-06	56	272	27	263	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMW23043.1	0.0	1	702	1	702
QCY38875.1	0.0	1	702	1	702
AYX83352.1	0.0	1	702	1	702
QQQ83202.1	0.0	1	702	1	702
QFR06559.1	0.0	1	702	1	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KNK_A	7.64e-124	309	532	2	225	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNK_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_A Chain A, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_C Chain C, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_D Chain D, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325]
3LAT_A	7.91e-123	322	529	6	213	Crystalstructure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis],3LAT_B Crystal structure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis]
7KWI_A	2.41e-62	556	702	3	149	ChainA, Bifunctional autolysin [Staphylococcus epidermidis]
4EPC_A	3.48e-59	556	702	21	167	Crystalstructure of Autolysin repeat domains from Staphylococcus epidermidis [Staphylococcus epidermidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CPQ1	1.50e-200	1	702	1	680	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1
Q5HQB9	1.50e-200	1	702	1	680	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
O33635	1.50e-200	1	702	1	680	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q6GI31	2.11e-186	1	702	1	588	Bifunctional autolysin OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=atl PE=3 SV=1
Q6GAG0	4.95e-186	1	702	1	581	Bifunctional autolysin OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=atl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.998980	0.000200	0.000200	0.000176	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002338_01955.