CAZyme Information: MGYG000002337_01093

Basic Information

• Species: Staphylococcus aureus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
• CAZyme ID: MGYG000002337_01093
• CAZy Family: CBM50
• CAZyme Description: putative cell wall hydrolase LytN

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002337_1|CGC14	41755.04	10.1004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002337	2749621	Isolate	not provided	not provided

• Gene Location: Start: 1187430; End: 1188548 Strand: +

Full Sequence      

MNKQQSKVRYSIRKVSIGILSISIGMFLALGMSNKAYADEIDKSKDFTRGYEQNVFAKSE
LNANKNTTKDKIKNEGAVKTSDTSLKLDNKSAISNGNEINQDIKISNTPKNSSQGNNLVV
NNNEPTKEIKIANLEAQNSNQKKMNKVTNNYFGYYSFREAPKTQIYTVKKGDTLSAIALK
YKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNSNSSTLNYLKTL
ENRGWDFDGSYGWQCFDLVNVYWNHIYGHGLKGYGAKDIPYANNFNSEAKIYHNTPTFKA
EPGDLVVFSGRFGGGYGHTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKAEVAHKVVHNYE
NDMIFIRPFKKA

Enzyme Prediction     

No EC number prediction in MGYG000002337_01093.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01476	LysM	5.78e-15	166	209	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	8.65e-15	165	208	1	44	Lysin motif.
cd00118	LysM	3.06e-14	164	208	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	3.00e-11	59	208	386	523	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.27e-09	59	208	460	591	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMO16818.1	1.52e-263	1	372	1	372
ASI55304.1	1.52e-263	1	372	1	372
AXG03368.1	1.52e-263	1	372	1	372
AXG00674.1	1.52e-263	1	372	1	372
AWR04644.1	1.52e-263	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IST_C	6.10e-08	234	368	8	138	ChainC, Lysin [Enterococcus phage IMEEF1]
4B8V_A	4.47e-07	166	209	44	87	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7A5Y8	1.08e-262	1	372	12	383	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain N315) OX=158879 GN=lytN PE=3 SV=2
Q6G9W6	1.08e-262	1	372	12	383	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=lytN PE=3 SV=2
Q7A123	1.08e-262	1	372	12	383	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MW2) OX=196620 GN=lytN PE=3 SV=2
Q99UM3	1.08e-262	1	372	12	383	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=lytN PE=3 SV=2
Q9ZNI1	7.30e-261	1	372	12	383	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=lytN PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998969	0.000216	0.000172	0.000148	0.000133

TMHMM  Annotations     

start	end
12	31