CAZyme Information: MGYG000002333_01489

Basic Information

• Species: Campylobacter_D coli_B
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_D; Campylobacter_D coli_B
• CAZyme ID: MGYG000002333_01489
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000002333_274|CGC1	87433.62	9.1287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002333	1554713	Isolate	United Kingdom	Europe

• Gene Location: Start: 8632; End: 10854 Strand: +

Full Sequence      

MAKLSIIIPFGTSKERPYIKERVANKANEYKSDDLVEYIFVEGFSSLEHLELKNLIENKG
HRYFKDATQQFNKAFSLGQCRNLGIVNAKSDVVMSLDVDCVISEKNLENILELISIKEID
KNPNAFLVLPCIFLNEFGTEFLQRYKLSLWDNIIIHDMNFDRKFIKFLTPASSTIIMNRF
KFLELGGNDQEFVGHGYEDFDLMMRILKNCTDFEAIPTNLEFDYRNWSFNDYKGFRALFS
VVGNEACAHGIYLYHLWHAEPNQNGYLDNRELNHQKFYQKLKNYKDIFDGPDTLIENEAK
NRNALVFFQQNSNLYSSLRAIMPYFEKLISAKEYYFFDEKDKFNSKNFLKFYHQNNITHI
IFPNSHANEKRLEIFQFIREKKLPFIVYDRGALPDSWFFDDKGFNYDSTSYDEKNWNKTL
NEEQKIKTLTYIEEVLKGEKFLEKQGLSKGSDNLKRKLGLRHKKIFFVPLQVKDDSVLKN
FTYEPFSYENFLNILNELAKKLFIENIVFVVKKHPLSLDLDKTTYDNLIFVPDDTNLNDL
LGLCNAVLTLNSGVGVYAILAKKPCIVCANAFYRFDNLNLQANNEKELFEHILNISQGNF
NFDEEKALRFIHYLRYEFYSFGKSYYKKSEENGRIYTKVYKIEFYSLILFGKKLLDFNSI
KKQNYKLNSPIYKPYIYEIKEKKLKRDLKGNGLIIATQAKISHFKFYRLFRKFITSPKDF
IMDSKKPFMKPIKLILRKAL

Enzyme Prediction     

No EC number prediction in MGYG000002333_01489.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	283	5.1e-82	0.9963768115942029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	2.03e-73	5	283	1	276	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG4092	COG4092	2.70e-57	1	285	1	294	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd16438	beta_Kdo_transferase_KpsS_like	4.81e-20	466	618	94	247	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
pfam05159	Capsule_synth	1.13e-09	379	583	21	276	Capsule polysaccharide biosynthesis protein. This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS and LipB.
cd16441	beta_Kdo_transferase_KpsS	6.27e-08	454	578	134	268	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKF79265.1	0.0	1	740	1	739
ARQ97898.1	0.0	1	740	1	742
ANE34504.1	0.0	1	740	1	741
VEJ07650.1	1.22e-260	1	740	1	739
AJC87286.1	2.26e-229	3	726	2	714

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002333_01489.