CAZyme Information: MGYG000002330_05578

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_05578
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1215	MGYG000002330_169|CGC2	138878.13	5.1659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 44241; End: 47888 Strand: -

Full Sequence      

MEQQLKSVYISGMDFEPEERRQRILPDGMLEIYNRKSPYMVHAKMNLPLYGNIWVMAHNQ
GEGYTGDFVDFVSEAVRTYLYEADRLSQGLELSAQARGHLDAAREYEHLADRGVDTPENR
LYALSHAVYAAEMVLLERSQKQLREAPRRDLKLGCNFFKYSSPNARYAKYFKEVFDFATL
PFYPRDTVPEKGKYEYGYIEHALSFLQENHITPKGHPLWFGHSEVNPEWLKKLSYEELKE
QAREIALHHVSAYRGRVSVWDAMNEAHDWANCFELNQDQLTELTRICCDALKEADPKAES
VVNVCLPFAEYVAGRYNCYGSLPEKLTSPLAYFRNLEEKEIAFDTVGIQLYFPARDMVAL
SRLLDAFKQLGKPIHITEMGANGGVRSLTQAGAGSSWSQLNMSEGIWHEGWGERTQADWM
EYMYTILAARDEIKALTWWDFIEPSFFGNGAFLYENEIPREIFFRLKALKANITGASRRG
PDREAADGRIDRKKVVKRHNPILTAIDYESPLTVGNGFFAYTFDVTGMQSLGRYYARNRN
PLCTMAEWGWHTTPFGTDKFACGFGEVEMTEYDFCGRKVAYAAEKKEGNEEVYEWLRHNP
HRYSLAEVGLLYDGREIVPEDIGSVRQELDLYEGTAVSEFKVGKEACSVLTACGDEDCVG
FSLRSQALKDGKIKVRIRLPYPGTKICGADWEAGDRHTTELLQQKENSVLLIHRMDRDAC
EIRIGWEGNGVRLEQAASHEFLLSSEEESLCFSLCFRNRRNNPSVYGKRSQDALLLSEEL
TVEEICMESRRRWGQFWQKGGMVDFEGTTDVRGMELERRIILSLYLTGLQCTGYMPPQET
GLTCNSWYGKSHLEMHLWHAAYLPLWHRGELLERSIPWYTDILDKAKENAARNGYAGARW
PKMVSCDGMESPSVIATLLIWQQPHILYMLELLYQEKKEQDENEAEAFLERMFGLVKETA
DFMADFAVENRENGEYDLLPPIIPAQERHAPQDTVNPAFEVEYWRFGLSIAVNWAKRKKE
SHENYALWEKVGSHMAKPPVSGGLYIAHQHCPDTFLHYNTDHPSMLGALGLLPGEGVDCE
VMKATLDRVLECWDFDSMWGWDFAMMAMTAVRLGCPELAVDLLLMDKPKNSYVASGNNYQ
KTSDKLPLYLPGNGSLLLAVPLMLEGIHADGEEAGQEKGRNRGQETRQGEKGAWPGFPGD
GSWKIRYEDISGFPY

Enzyme Prediction     

No EC number prediction in MGYG000002330_05578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	150	447	1.3e-29	0.8712871287128713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	1.47e-12	189	445	8	238	Glycosyl hydrolase family 10.
COG3693	XynA	1.39e-10	189	379	74	258	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	7.25e-10	189	441	51	275	Glycosyl hydrolase family 10.
cd19608	GH113_mannanase-like	0.004	329	449	160	289	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQZ02680.1	1.80e-237	2	473	18	492
AEF81843.1	1.06e-224	5	473	21	488
ANW97941.1	1.87e-185	5	475	21	492
AGI38568.1	1.87e-185	5	475	21	492
AGC67515.1	1.87e-185	5	475	21	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NIY_A	5.12e-12	186	467	70	333	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
7D88_A	6.74e-12	164	378	99	300	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
1VBR_A	1.09e-11	186	467	54	317	Crystalstructure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
7D89_A	6.39e-11	164	377	99	299	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
3WUB_A	7.25e-07	187	379	52	234	Thewild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q60041	5.17e-12	154	469	41	338	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
Q60042	2.48e-06	191	379	420	605	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
B4XVN1	6.55e-06	187	379	90	272	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_05578.