CAZyme Information: MGYG000002329_02897

Basic Information

• Species: Dielma sp001305055
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma sp001305055
• CAZyme ID: MGYG000002329_02897
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000002329_20|CGC1	54727.03	5.3994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002329	3357599	Isolate	not provided	not provided

• Gene Location: Start: 22865; End: 24295 Strand: -

Full Sequence      

MPFRENFLWGGATAANQCEGGYKEDGRGLANVDVVPHGPDRMKVSCGRLKMLEHQAGYYY
PACEAIDMFHHYKEDIALFGEMGFKTYRLSIAWTRIFPKGDESEPNEAGLKFYEDLFKEC
HKYGIEPLVTITHFDCPIHLIKEYGGWKNRRLIDFYKNLVTVLFTRYKGLVKYWLTFNEI
NMILHMPFMGAGLVLEADENEAQVKYLAAHHELVASAWATKIAHEIDPENKVGCMLAAGV
TYPYSCDPKDVFEAQRKNRDNYFFIDVQSRGEYPAYALKEFEREGIDIGMSDEDKRILKE
HTVDFISFSYYSSRCTSTDPEILAKEMSGNAFKGVRNPYLKASQWGWQIDPLGLRITMNE
LYDRYQKPLFIVENGLGARDEADENGYVEDDYRIDYLREHIKAMKAAVELDGVELWGYTS
WGPIDLVSASTGEMSKRYGFIYVDKDDEGNGTLKRSKKKSFDWYKKVIATNGGDLQ

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	472	3.3e-144	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	475	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	475	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	5	475	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	472	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	476	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10677.1	6.44e-292	1	475	1	473
BAM47861.1	1.34e-289	1	475	1	474
QCR00398.1	7.79e-282	1	475	1	474
QJC66361.1	7.79e-282	1	475	1	474
QZN88284.1	3.29e-281	1	475	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.34e-204	3	475	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.30e-185	5	475	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.71e-185	5	475	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	4.13e-184	1	475	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	1.62e-181	5	475	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	3.63e-222	3	476	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	9.54e-207	3	475	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	3.26e-189	3	476	4	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	1.81e-188	1	476	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	2.26e-183	1	475	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002329_02897.