CAZyme Information: MGYG000002329_00541

Basic Information

• Species: Dielma sp001305055
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma sp001305055
• CAZyme ID: MGYG000002329_00541
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000002329_2|CGC5	56464.88	5.1713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002329	3357599	Isolate	not provided	not provided

• Gene Location: Start: 240379; End: 241839 Strand: +

Full Sequence      

MKKGFSEGFLWGGAIAASQADGAYNQGGKGLDTQDLRYFDAAWTKEERAMFKNRRINGEK
YKKALTDDDIVHYPFRWGIDFYNHYKEDVKLFAELGIKVLRTSINWARIYPNGDDEMPNE
EGIKFYIDLFDECRKYGIKVFATILHYNIPVHLVEKYGGWKNRKTIDFYVNYAVTLFERL
GDRVDYWLPFNEFNAGRFNPYNGVCLVEDQEPDYVNAIFQCLHHQFIANALTIKAGHEIL
PGSMIGGMIARFTTYPATCHPDDVMQMILDDQYSNWFYLDVMARGKYPAYIERYFDKENI
QIKKEAGDDMILSENTIDFTAFSYYFSQVSTTKQGWEKTAGNLIMANKNPYLETSEWGWQ
KDPVGLRITLNQIYDRYQLPVFVAENGLGAKDNLEADGTIHDPYRIDYLKTHIAQMKEAV
IDGVDLLGYTMWGFIDIVSCGPMEMSKRYGVIYVDRDDEGKGTNKRYKKDSFYWYKKCIE
TNGDIE

Enzyme Prediction     

No EC number prediction in MGYG000002329_00541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	483	3.1e-130	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	5	483	4	470	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	2	486	1	457	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	486	3	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	6.78e-178	4	484	3	474	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	5.26e-154	1	484	1	475	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM12924.1	9.49e-270	1	483	1	484
VEF34955.1	4.82e-261	2	485	6	488
QGT97346.1	4.82e-261	2	485	6	488
VEA68230.1	1.43e-259	1	484	1	484
QOY61128.1	1.59e-252	1	483	2	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.10e-184	3	484	6	467	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.39e-149	9	484	12	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	6.61e-148	7	484	9	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.88e-147	7	484	9	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	2.37e-147	5	484	20	483	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.88e-182	2	484	5	467	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	9.67e-164	5	484	4	471	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	7.03e-161	5	483	7	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	3.41e-155	9	484	8	477	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q48409	7.67e-153	3	483	2	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.901530	0.097225	0.000774	0.000173	0.000114	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002329_00541.