CAZyme Information: MGYG000002328_05635

Basic Information

• Species: Enterocloster asparagiformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster asparagiformis
• CAZyme ID: MGYG000002328_05635
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		47345.08	8.2146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002328	6168028	Isolate	not provided	not provided

• Gene Location: Start: 15507; End: 16718 Strand: +

Full Sequence      

MVRDKKEEKNIHILRPLYVPVSNAIRRTFGTRGYVFAICKFLRRLPEMYFRNYINSYRSP
YGYKSIDEERHKVINMQVHVLGDNNKGKVIMLLENQSHHAGFCAIWVYILNRLSFSDKMG
FYHVIDWEESEFYQEDHPIHGSTSIFEYYFEQPSGISLADARKSNFVVYDWNSPEYGYND
AFHVGDNNDYRFTDKDVEQFAKIQRKYIHLHKEIELSIKDQVEKLFQGKTNVIGVHARGA
DTKIGYKGHPTIVTSEDYINETEKMVKKFKADMIFLATDDQVMLDQFKNAFGNRLVYYED
VIRSTSTIMNCFIEEKRENHHYLLGLEIIRDVYTLAACRGFVCGMSYVGFIVQIIKKANE
ECFDDFIRISKGINMDGLDLNKSTVRKKIGNDWKKELKQKGRI

Enzyme Prediction     

No EC number prediction in MGYG000002328_05635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	197	346	3.3e-16	0.44025157232704404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11296	O-FucT_like	2.00e-08	205	352	46	197	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11548	NodZ_like	3.15e-05	113	296	21	229	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11302	O-FucT-1	1.84e-04	206	292	180	291	GDP-fucose protein O-fucosyltransferase 1. The protein O-fucosyltransferase 1 (Ofut1 or O-FucT-1) adds O-fucose to EGF (epidermal growth factor-like) repeats. The O-fucsosylation of the Notch receptor signaling protein is dependent on this enzyme, which requires GDP-fucose as a substrate. O-fucose residues added to the target of O-FucT-1 may be further elongated by other glycosyltransferases. On top of O-fucosylation, O-FucT-1 may have other functions such as the regulation of the Notch receptor exit from the ER. Six highly conserved cysteines are present in O-FucT-1, which is a soluble ER protein, as well as a DXD-like motif (ERD), conserved in mammals, Drosophila, and C. elegans. Both features are characteristic of several glycosyltransferase families. The membrane-bound pre-protein is released by proteolysis and, as for most glycosyltransferases, is strongly activated by manganese. O-FucT-1 is similar to family 1 glycosyltransferases (GT1).
cd11300	Fut8_like	0.003	219	346	166	297	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU47985.1	1.90e-250	1	397	1	397
BAZ48063.1	6.13e-10	188	375	142	323
AUS97801.1	5.28e-09	93	361	16	299
ANX01438.1	1.18e-07	91	350	14	289
AVQ71574.1	1.40e-07	189	365	137	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002328_05635.