CAZyme Information: MGYG000002328_03214

Basic Information

• Species: Enterocloster asparagiformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster asparagiformis
• CAZyme ID: MGYG000002328_03214
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		56662.46	4.2645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002328	6168028	Isolate	not provided	not provided

• Gene Location: Start: 3688; End: 5223 Strand: -

Full Sequence      

MHDGTPIPNVLYRGIDVSRWQGDVNWRQVAADDVSFVMLGTRSKGAVDPYFHKNIQEAHD
AGIQVGVYIYSLALNPEMAVQEADFVLDLIKDYPVSYPVAFDMEDSTQGVLSKEELAAIA
NAFCQRIKDAGYYPIIYANENWLKNKLDMSLMNYPVWVARYNAMYTYSSPVMWQATSTGA
VNGIGGNVDIDFQFKDFSGVIPANLWRTIGGNTYYYQNHAMQKDTWINDGNGWYYMDGDG
FAKKGWFTESGKRYYLDDGTGKMQYGWKDQDGKWYYLGSSGAASTGWVNDNGAWYFMDHD
TAVMRTGWLDEGGKRFFLEDSGRMATGWTNQDNKWYYLDGSGALATGWINADGARYYSGS
DGVMHTGWLQDGGHWYFMRGNGAMATGWRDMDGSWYFFNQDGQMVTGWQSIDGIWYYFDG
NGHMATGMIDVGGVKYYLDDQGRMAANTQVTVDGVNYTADGSGALSLVEQPPAEGGEASA
ESLDGQNSPNSGQSGNNDVPVITGVNGGPGV

Enzyme Prediction     

No EC number prediction in MGYG000002328_03214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	15	184	2.5e-47	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.67e-78	13	194	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	2.72e-68	266	466	444	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.80e-66	243	461	442	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.58e-61	285	467	486	667	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.43e-58	243	461	485	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR03194.1	2.72e-127	1	224	89	312
ANU47907.1	2.72e-127	1	224	89	312
QRP37172.1	1.56e-126	1	224	89	312
QJU23033.1	1.56e-126	1	224	89	312
ASN98018.1	1.56e-126	1	224	89	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	7.31e-18	13	191	21	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	4.42e-17	13	191	21	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WW5_A	7.07e-15	15	194	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.66e-14	15	194	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
5A6S_A	1.39e-11	16	197	26	205	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	3.18e-15	14	191	69	252	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	4.30e-15	14	201	69	258	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	7.84e-15	14	201	69	258	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P26836	8.08e-13	13	196	10	198	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	1.92e-09	13	189	83	275	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002328_03214.