CAZyme Information: MGYG000002326_01341

Basic Information

• Species: Alkalihalobacillus alcalophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_H; Bacillaceae_D; Alkalihalobacillus; Alkalihalobacillus alcalophilus
• CAZyme ID: MGYG000002326_01341
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	MGYG000002326_60|CGC1	78057.44	3.9261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002326	4217920	Isolate	not provided	not provided

• Gene Location: Start: 25779; End: 27926 Strand: +

Full Sequence      

MKTIAVSRDQRGLFALVFSLLLVLSSLSLLIQPTNTVHAEKASIVLGYYTSWNPPENLDP
NKVTHINYAFADVCWEGEHGNPDNEEIPDDEPKTWSCKDFQGNEAELANGTIVLYDYETD
LVELPKLAQLKNQNKDLKTLISVGGWTLSNNLSLVARTDETRETFAQSAVDFVREFDLDG
LDLDWEYPVAAGMPNNHRDPSDKENHTLLLQAVRDAFNEAEKEDGREYLVTIAGAATWAY
AENNELGKIAEIVDYMAIMSYDINGTWTGLTGHNSPLYFDPLEEQVRGWSFGIASTPNVY
GAVPKDKLLLGLPFYGHSWAGCNEDNEGKKVMENGAYQQCAAGWEKPGLGGGTLNYDVVK
PLINQDGYHYFFDNVAKVPYLYNESKGEFISYDNVESLGYKVNFIKETGLAGAMVWDLAG
DDEDYNLLKTVSYGLGVSNEAPEPDPVPEVEIGLTDEFAPVSAGSLLKVLKDGEATGVQI
QLPTDLPEGTKLKIEEATEGMDKLSGLKADGPVYTFTFEYPDGEAFTSEEGFGLTFPVKE
DSNDPALYYFNSEDGEWEKVSNEVAQNEITVIVSHFSTFGIFVEDEEIDNDGSVDGNKED
EDEDDNGTGTGGNGDDDNGTGTGGNDDGDNGTGTGGNNDDDNGDDNGTDKGKDDANGIDK
GTNNDKTDAGEKSGSSNKLPNTATNLYNMLAVGFIVILVGAGLFIYQRRKELVKE

Enzyme Prediction     

No EC number prediction in MGYG000002326_01341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	44	427	9.9e-73	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.91e-120	45	421	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG3325	ChiA	8.60e-103	44	437	39	438	Chitinase, GH18 family [Carbohydrate transport and metabolism].
smart00636	Glyco_18	2.92e-98	45	421	2	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	5.75e-83	48	435	4	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
pfam00704	Glyco_hydro_18	6.95e-82	45	421	2	307	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAC12747.1	1.96e-312	2	712	7	690
SQI51386.1	1.69e-140	1	449	1	463
QRZ20136.1	6.11e-119	32	446	1	432
AIC93540.1	2.05e-115	40	432	32	435
QRE01775.1	3.88e-113	45	421	42	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	8.69e-113	31	421	1	406	ChainA, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	5.50e-98	40	421	34	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6KST_A	1.10e-76	45	421	9	357	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	5.87e-76	45	421	9	357	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	1.20e-74	45	421	9	357	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.07e-109	14	421	16	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P32470	2.75e-47	48	436	43	399	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
E9ERT9	2.60e-46	48	436	44	400	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
A6N6J0	2.71e-45	48	433	44	402	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
Q9BZP6	3.63e-45	48	439	27	391	Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.481761	0.514955	0.000842	0.000973	0.000661	0.000792

TMHMM  Annotations     

start	end
12	34
684	706