CAZyme Information: MGYG000002326_01095

Basic Information

• Species: Alkalihalobacillus alcalophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_H; Bacillaceae_D; Alkalihalobacillus; Alkalihalobacillus alcalophilus
• CAZyme ID: MGYG000002326_01095
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000002326_45|CGC1	30042.3	4.3809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002326	4217920	Isolate	not provided	not provided

• Gene Location: Start: 1762; End: 2586 Strand: +

Full Sequence      

MLKVLKRKSSKVAGMAIAAVALFSFAGADAASAHGYIEEPKARGLLCQEGANQDCGGVVW
EPQSLEGPKGFPGLSVADGEIASAGGVFPQLDQQSSNRWAKVDMNSGLNTINWHLTARHS
TSKWHYYITKPDWNPNLPLTRDQFELVPFYEIYDGGARPEQKVSHEVTVPQRTGYHVILG
LWDVADTENAFYNVIDVNFGGGTNPDPDPGEPDPDPDPGQPDPEEPELPDLPTWDPGTAY
TGGSQVIYNGKVYQARWWTLGEKPETASYVWEQL

Enzyme Prediction     

No EC number prediction in MGYG000002326_01095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	34	198	1.3e-53	0.9943820224719101
CBM5	232	271	1.7e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	6.12e-92	15	204	7	198	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	1.73e-86	6	203	2	211	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	9.19e-69	34	198	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	7.09e-54	34	197	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd12215	ChiC_BD	3.29e-16	232	273	1	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAC12766.1	1.24e-128	4	274	4	263
AIC95922.1	6.23e-124	14	274	15	263
AST94529.1	3.23e-123	22	274	22	261
QNM44967.1	3.23e-123	22	274	22	261
BAD63699.1	3.75e-122	22	274	22	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WSZ_A	7.32e-68	34	198	1	165	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
2BEM_A	2.76e-60	34	198	1	167	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	1.57e-59	34	198	1	167	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
2YOX_A	1.86e-57	34	198	1	176	Bacillusamyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOX_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOY_A Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens],2YOY_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens]
2YOW_A	1.92e-57	34	198	1	176	Bacillusamyloliquefaciens CBM33 [Bacillus amyloliquefaciens],2YOW_B Bacillus amyloliquefaciens CBM33 [Bacillus amyloliquefaciens],5IJU_A Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens],5IJU_B Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	5.97e-56	31	202	25	198	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q5E183	2.00e-52	20	201	10	206	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1
B5ESR7	2.00e-52	20	201	10	206	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
A7N3J0	3.77e-51	11	269	3	243	GlcNAc-binding protein A OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) OX=1224742 GN=gbpA PE=3 SV=1
Q8D7V4	1.05e-49	31	201	21	202	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999109	0.000149	0.000189	0.000146	0.000138

TMHMM  Annotations     

start	end
12	34