CAZyme Information: MGYG000002325_01936

Basic Information

• Species: Listeria monocytogenes_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes_B
• CAZyme ID: MGYG000002325_01936
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000002325_1|CGC26	64059.81	6.0229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002325	3017944	Isolate	Canada	North America

• Gene Location: Start: 1927335; End: 1928993 Strand: -

Full Sequence      

MPWRGILDELENKIIDQLTEDEEHATYNGKWHGFLTIGYKNKRAIVINFSYLCLANLINE
MKKSAIKNQTEEAISFKIDVAVDYRLENLGEWNKKALKTKKNYYRRGIALNENFKIALME
QEINANAILLPGDEGLAINVENMNRYLIQTNKNQAQLNLTVDSTIVTFNTVGWFFDGKKI
HELEPSELEHGRRSTKQLTPDAVFELVGNAGNYLASQVNQTGEFNYGWFACFDKKIKHYN
SLRHASTTYSMLEAYELTGDKTILEAATSTLTYLEQNFIYEKDELAFLIEPGLREVKLGG
SAATLLALTKYMKITGTKTYLPLSRKIANAIISLQEENGKFTHVLEYPSLEVKDIFRIIY
YDGEAVFGLLRLYEIDRDSKWLEAAAKSFDHFIRDDYWQNHDHWLSYCANEITKYIPDEA
YYEFGMKNAFDNLPFIYGRETTFPTFLELTVATKEMSLRMETEDLQKLLHDYPLAELEKT
ITKRAIYQLNGYFYPELAIYYKNPARIDGSFFIRHQSFRVRIDDVEHNISGYVRYHHLLK
QGKLSAEAETVK

Enzyme Prediction     

No EC number prediction in MGYG000002325_01936.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04434	LanC_like	2.61e-05	205	339	123	259	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04434	LanC_like	2.98e-05	249	451	9	184	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04792	LanM-like	1.13e-04	245	391	549	682	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG1331	YyaL	7.46e-04	249	392	418	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam07470	Glyco_hydro_88	0.003	244	390	31	159	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGX91315.1	3.58e-122	94	535	95	542
ASG64311.1	6.42e-120	63	535	402	884
QLF93148.1	6.48e-117	85	548	76	554
QGN37502.1	4.68e-115	48	535	53	544
AOV11456.1	1.33e-114	43	535	48	544

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002325_01936.