CAZyme Information: MGYG000002325_00814

Basic Information

• Species: Listeria monocytogenes_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes_B
• CAZyme ID: MGYG000002325_00814
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000002325_1|CGC18	40108.22	4.5106

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002325	3017944	Isolate	Canada	North America

• Gene Location: Start: 827087; End: 828115 Strand: +

Full Sequence      

MKWSEYANLAQLSLEKFYLADTKEQFLNNFYPTENPEEDNKVFNYWWLAHLVEVRLDAYL
RTKKQADLEIAENTYLHNKNRNGGTLIHDFYDDMLWNALAAYRLYKETGKPIYLEDAQLV
WQDLVDTGWNNIMGGGFAWRRPQMYYKNTPVNAPFIILSCWLYNEFNETKYLEWAMKTYE
WQTKVLVREDGFVEDGINRLEDGAIDYEWKFTYNQGVYIGANLELYRITKDAKYLDTANK
TADISLKELTEDGIFKDEGSGGDEGLFKGIFYRYFTDLMEETANKTYRNFVFNSCQALVD
NAKLDGYLLMGMNWKENPSGKIPYSAELSGMIALEMAAKLER

Enzyme Prediction     

No EC number prediction in MGYG000002325_00814.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	23	327	8.9e-87	0.8687150837988827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	0.0	1	341	1	353	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	5.53e-32	20	314	6	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	0.002	123	277	406	517	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG1331	YyaL	0.006	204	267	258	331	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKG87735.1	2.07e-264	1	342	1	342
APO60952.1	2.07e-264	1	342	1	342
AKP37919.1	2.07e-264	1	342	1	342
AKI45940.1	2.07e-264	1	342	1	342
CBY48362.1	8.41e-264	1	342	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	2.07e-242	2	341	2	341	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	1.68e-61	3	341	54	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	5.24e-60	3	341	55	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	4.06e-59	3	341	55	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	1.20e-24	44	286	37	282	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05031	9.36e-08	109	335	145	389	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002325_00814.