CAZyme Information: MGYG000002323_02575

Basic Information

• Species: Escherichia sp000208585
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia sp000208585
• CAZyme ID: MGYG000002323_02575
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		33723.38	8.7225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002323	4514939	Isolate	not provided	not provided

• Gene Location: Start: 394328; End: 395218 Strand: -

Full Sequence      

MNSNIYAVIVTYNPELKNLNALITELKEQNCYVVVVDNSTNFTLKDKLADIEKVHLICLG
RNEGIAKAQNIGIRYSLEKGAEKIIFFDQDSRIRNEFIKKLSCYMDNENAKIAGPVFIDR
DKSHYYPICNIKKNGLREKIHVTEGQAPFKSSVTISSGTMVSKEVFEIVGMMDEELFIDY
VDTEWCLRCLNYGLLVHIIPDIEMVHAIGDKSVKICGINIPIHSPVRRYYRVRNAFLLLR
KNHVPLLLSIREVVFSLIHTTLIIATQKNKIEYMKKHILATLDGIKGITGGGRYNA

Enzyme Prediction     

No EC number prediction in MGYG000002323_02575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	167	1.4e-17	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01556	rhamnosyltran	2.16e-150	10	284	1	281	L-rhamnosyltransferase. This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
cd02526	GT2_RfbF_like	1.43e-92	7	239	1	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
COG1216	GT2	2.36e-31	4	248	4	261	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	2.27e-18	7	238	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	6.55e-17	8	206	2	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQE43631.1	2.76e-214	1	296	1	296
QIF18142.1	2.76e-214	1	296	1	296
ACD37171.1	2.76e-214	1	296	1	296
AUY05183.1	2.76e-214	1	296	1	296
QHI93012.1	2.76e-214	1	296	1	296

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37782	1.30e-213	1	296	1	296	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2
D4GU63	2.12e-14	1	290	16	302	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002323_02575.