CAZyme Information: MGYG000002323_02395

Basic Information

• Species: Escherichia sp000208585
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia sp000208585
• CAZyme ID: MGYG000002323_02395
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563	MGYG000002323_13|CGC3	63373.52	6.3797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002323	4514939	Isolate	not provided	not provided

• Gene Location: Start: 227816; End: 229507 Strand: +

Full Sequence      

MKPRVPRHLQRMALIPTTVLLCFATLSAQAEEIAVTPQSPDILLGPLFDDVQNAKLFPDQ
KTFADAVPNSDPLMILADYRMQQNQSGFDLRHFVKVNFTLPKEGEKHVPPKGQSLREHID
GLWPVLTRTTESTEKWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLGESGHWDKVADM
VANFGYEIDTYGHIPNGNRSYYLSRSQPPFFALMVELLAQHEGDAALKQYLPQLQKEYAY
WMDGVENLQAGQQEKRVVKLKDGTILNRYWDDRDTPRPESWVEDIATAKSNPNRPATEIY
RDLRSAAASGWDFSSRWMDNPQQLSTLRTTSIVPVDLNSLMYKMEKILASASKAAGDNAM
ASQYETLANARQKGIEKYLWNDQHGWYADYDLKSHKVRNQLTAAALFPLYVNAAAKDRAS
KMATATRTHLLQPGGLNTTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQEDVAMDISWHF
LTNVQHTYDREKKLVEKYDVSTTGTGGGGGEYPLQDGFGWTNGVTLKMLDLICPKEKPCD
NVPATRPTSASATQPTKVTEPTP

Enzyme Prediction     

EC	3.2.1.28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	56	531	4.1e-191	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13270	treF	0.0	31	531	33	545	alpha,alpha-trehalase TreF.
PRK13272	treA	0.0	11	535	8	539	alpha,alpha-trehalase TreA.
COG1626	TreA	0.0	21	538	35	558	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13271	treA	0.0	3	563	6	567	alpha,alpha-trehalase TreA.
pfam01204	Trehalase	0.0	55	532	1	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLP29653.1	0.0	1	563	1	565
VEF96960.1	0.0	1	563	1	565
AUT26741.1	0.0	1	563	1	565
VED79088.1	0.0	1	563	1	565
QLX30557.1	0.0	1	563	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JF4_A	0.0	31	563	1	535	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
2JG0_A	0.0	31	563	1	535	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	0.0	34	547	41	554	Structureof periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
7E9U_A	4.77e-83	86	530	90	552	ChainA, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	7.10e-82	86	530	90	552	ChainA, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4ZTN8	0.0	1	563	1	565	Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treA PE=3 SV=1
Q0TIH3	0.0	1	563	1	565	Periplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=treA PE=3 SV=1
Q0T5J8	0.0	1	563	1	565	Periplasmic trehalase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=treA PE=3 SV=1
P13482	0.0	1	563	1	565	Periplasmic trehalase OS=Escherichia coli (strain K12) OX=83333 GN=treA PE=1 SV=1
Q1RCP3	0.0	1	563	1	565	Periplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) OX=364106 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998947	0.000252	0.000185	0.000161	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002323_02395.