CAZyme Information: MGYG000002323_02260

Basic Information

• Species: Escherichia sp000208585
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia sp000208585
• CAZyme ID: MGYG000002323_02260
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	MGYG000002323_13|CGC2	71131.71	5.8581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002323	4514939	Isolate	not provided	not provided

• Gene Location: Start: 89251; End: 91176 Strand: -

Full Sequence      

MNRRWLTLCISVLGLFVAGISQGISDARADDICKNGAMVPDEYCRFFIHYGPEAPGKLDI
RISDALKIPDQDAAKTRAIGLIISISKYPLLHADIPAAAVDGQRMADFLINGQKFDEVIL
LKDQDASLDNINYFLKEYLPARGMMFDKKARLLIAYSGHGRFGTQNGNSDKAPAFVLSNA
TDIDGSKGMYEMPALNAQLNILAKRYFHVLTLVNACFGSGLFGMTDGAGNSNAYSKPGAY
AIAAGDDKTEVYSLEKDKGSVFFDTLIKGVADGVADERFGKSYMVKIDGKKEYYAGITRT
LSLFIYVNDQYIKINEKLDEEGKGIHLSDAWIGATENPAGPGGFFFINDPAVSRLDKKTQ
LSAGNADEFTNIDKTAYSIKEPPTAPDEPKNKDITPIEIPYGPVSAIPNRPDIRIFKTPD
IYPISGHDISSNDGEIDWKLFQEKSPARFVYVRVVGWRGPDSSFKAHWKQLADSKFDRGG
YFKFDFCLTPEAQLETAKSLLPEDPKMLPPGILLVNPEGEDTTQLACFKKSGMVNARNDI
LRFAALIYKNYHKIPIFYGNHNNLSHFMDSRFDQYMVWMGYWGQAGVKLEGRNPWTLWQY
SGNEKVPGIGHSTESEVFFGTEEQYAQFKAGENNVALAAVN

Enzyme Prediction     

No EC number prediction in MGYG000002323_02260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	428	609	7.1e-22	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06413	GH25_muramidase_1	5.42e-24	422	620	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	8.51e-21	426	620	2	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd00599	GH25_muramidase	9.62e-19	428	611	4	179	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG3757	Acm	1.19e-12	384	633	21	268	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	1.27e-12	427	609	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLP29775.1	0.0	1	641	1	641
VED78780.1	0.0	1	641	1	641
QLX30378.1	0.0	1	641	1	641
VEF96838.1	0.0	1	641	1	641
QLP27221.1	0.0	1	641	1	641

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005021	0.968129	0.025133	0.001132	0.000296	0.000247

TMHMM  Annotations     

start	end
5	24