CAZyme Information: MGYG000002322_01546

Basic Information

• Species: Escherichia marmotae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia marmotae
• CAZyme ID: MGYG000002322_01546
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000002322_23|CGC3	22198.58	9.7052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002322	4486744	Isolate	not provided	not provided

• Gene Location: Start: 268685; End: 269296 Strand: -

Full Sequence      

MKLRWFAFLIVLLAGCSSKHDYTNPPWNAKVPVQRAMKWMPISQKAGAAWGVDPQLITAI
IAIESGGNPNAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAY
LNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKINDLDADEFLEHV
AKNHPAPQAPRYIYKLEQALDAM

Enzyme Prediction     

No EC number prediction in MGYG000002322_01546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	53	197	5.8e-16	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	1.40e-157	1	203	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	1.17e-81	41	199	1	160	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.08e-56	34	199	187	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	2.15e-32	43	168	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.38e-28	1	201	93	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLX30566.1	1.41e-147	1	203	1	203
QLP27351.1	1.41e-147	1	203	1	203
QLP29644.1	1.41e-147	1	203	1	203
VEF96969.1	1.41e-147	1	203	1	203
AUT26209.1	1.41e-147	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	1.11e-134	17	203	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	3.54e-134	17	203	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
2Y8P_A	1.34e-133	19	203	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	3.84e-133	19	203	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	3.84e-133	19	203	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1XAN4	3.30e-147	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=emtA PE=3 SV=1
C4ZTN4	3.30e-147	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=emtA PE=3 SV=1
P0C960	3.30e-147	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=emtA PE=1 SV=1
Q3Z2V5	3.30e-147	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Shigella sonnei (strain Ss046) OX=300269 GN=emtA PE=3 SV=2
B1IU99	3.30e-147	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002322_01546.