CAZyme Information: MGYG000002320_01611

Basic Information

• Species: Enterococcus_B lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B lactis
• CAZyme ID: MGYG000002320_01611
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37959.27	4.2739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002320	3009500	Isolate	Ireland	Europe

• Gene Location: Start: 96494; End: 97516 Strand: +

Full Sequence      

MKLKITVICSVVFSLFFFLLLFLVIFFADDTDSGENNKDSSIPEGGVTVSPEVLAHRPLI
EKYGKEYGIEDYVSYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSE
LLTSAEQQGVDIDSVIQSYNYGGGFLNYVRSHGKKYTYELAEQFSKEKSGGQKADYPNPI
AIPVNGGWRYNYGNQFYVQLVSQYLTDTSPTEFDDETVQVIMDEALKYEGFPYVFGGASP
TTSFDCSGLIQWVYDKAGISLPRVAQDQYDATQEISMEEAQAGDLIFFHSTYNAGTYVTH
VAIYLEGNRFYHAGDPIGYGDLSSRYWQDHLIGARRVIHN

Enzyme Prediction     

No EC number prediction in MGYG000002320_01611.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.07e-74	50	205	1	165	Lysozyme-like.
cd16891	CwlT-like	1.65e-74	56	205	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	3.12e-35	230	336	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	7.81e-29	217	335	74	197	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	1.30e-23	209	337	357	481	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR41534.1	1.12e-242	1	340	1	340
QCK28797.1	1.12e-242	1	340	1	340
AUU64178.1	1.12e-242	1	340	1	340
AWI92498.1	1.12e-242	1	340	1	340
AIL56899.1	1.12e-242	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	6.12e-228	29	340	2	313	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	3.52e-140	32	337	3	306	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
6B8C_A	2.04e-13	221	316	31	122	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
4XCM_A	5.78e-13	210	337	108	230	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
2HBW_A	2.74e-11	233	338	114	227	ChainA, NLP/P60 protein [Trichormus variabilis ATCC 29413]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.74e-76	47	337	51	328	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	9.93e-26	56	227	55	220	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P0DC91	1.43e-20	53	197	30	181	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
P0DC90	1.43e-20	53	197	30	181	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
Q99ZN9	2.74e-20	53	197	30	181	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.880007	0.117984	0.000965	0.000276	0.000170	0.000609

TMHMM  Annotations     

start	end
5	27