CAZyme Information: MGYG000002312_00469

Basic Information

• Species: Blautia_A sp000285855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp000285855
• CAZyme ID: MGYG000002312_00469
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000002312_5|CGC2	94143.12	6.4741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002312	4168980	Isolate	France	Europe

• Gene Location: Start: 196360; End: 198810 Strand: +

Full Sequence      

MQRELYEVEKDRFDLKDSSVYHLQGTWPKDYKAEAVLDGEPLPVVISAQERVSALERFKD
LDLVNGERVQMEVRLPAELEGKKKLGIYAVKGGKRIQWFSASAAQLQKKQGKPQYFIESI
EVESGEKICRVRGWAAFDRTLTIRLEDRSRKKIPCEITRLKRVDVQNQYQETEIDEKSGF
FFEFHYDSVKEFYIVFEAGNVRTLRLVHLQPQKRLAEKAAVYFRKGSRYMKLHGAAALTG
KVFGKVMNRKNRPVDYSKWIVKHLPDKAELAEQRKTKFSWNPKISLVIPLYKTPEKYLQQ
LIDSIQAQTYENWELCLSDGSGADSPLSEFLTTMEKSDARIRVIRNAKALQIAENTNGAI
RAATGDFIAFADHDDELTPDALFQCVKALNQEKEIKVLYSDEDKMSMDGHKFFQPHFKPD
FNIDLLCTVNYICHLFVVKKELIDQVGMLRKEFDGAQDYDFVLRCVEAAGREYIRHIPRI
LYHWRCHEDSTAENPESKMYAFDAGQRAIQAHYDRMGIPVEIQKGEYLGLYRTKFLWEEK
PLISIIIPNKDHIDDLKRCINSIEAKATYRNFEYVIVENNSEEETTFDYYRELEASNPKA
HVVYWDGIFNYSAINNFGASHAKGEYLLLLNNDTEIISPDCLEQLLGYCMRPDVGAVGAR
LYYEDDTVQHAGVVIGFGGIAGHCFVQQKRDATGYCHRIICAQDYSAVTAACMMVKRQAF
EKVGGLSEEFQVAFNDIDFCLRLGEAGYLVVYNPYAELYHYESKSRGLEDTPEKVARFNR
EIASFEKHWGKVLDKGDPYYNPNLTLDSQDFSLKRI

Enzyme Prediction     

No EC number prediction in MGYG000002312_00469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	285	397	1.2e-21	0.6529411764705882
GT2	544	723	1.1e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.26e-99	282	486	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.58e-45	545	762	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.84e-32	541	767	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.16e-19	544	720	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	2.29e-19	295	491	10	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL21587.1	0.0	1	816	1	815
QCU01344.1	0.0	1	816	1	815
QBE99396.1	0.0	1	816	1	816
QIB58019.1	0.0	1	816	1	816
QMW77451.1	0.0	1	816	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.27e-07	284	375	7	95	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	6.02e-07	282	380	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.03e-148	282	813	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.19e-105	232	815	245	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.27e-12	282	466	8	195	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71054	2.11e-11	282	565	5	273	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
Q4UM29	2.34e-10	282	633	14	381	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002312_00469.