CAZyme Information: MGYG000002310_04473

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_04473
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1106		121298.75	5.8601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 142388; End: 145708 Strand: -

Full Sequence      

MQLLHPPPDRFGPQLLQVEGRNALVLIDTVDPPTERVAFDIDGQPVAASIVHLHSRDFLR
QLNLLRNGRFDDECSDWHPIGVADTLVQTGRDIAPQWTLSGGHTGFVSVPSHVESIEVLY
SDSSAPGDLSIAAGERYAFEGLFGSHRCRADLRLTVFDVDGDVIADHRRSIEKKPGGNVP
SGYAKVNFSFRAPRGAASVRIGLTIRRDEEAQIRSAEPAVLFMTGLAFGACEQSPVSWRN
YLLNRDAVERVRHGAHVVQFRLPRMTSGEFGKDVEVNAVDRHTGKPLTPTPILLRGSPGL
SFHPYGFDGVTLSGALSGAAGGEVLDLLVDSEPAATLAVPSPTDMGAQKIALRIADRFLD
GSPRLVEVSERETGQILYQVAEVLKPLTTDWAMLGEQGWAPWLSGHNPLARERYRSLALH
IEAADEHGGNDALVQLQQCHSVLRQSNFQLSDLLPLRVPESAQPDVSIVVDAGESATDAY
RSVAAILFAFNRATFDITLVHSLLQEDRDRLQPLLDGLTFLEVLPGEPRSAALNRAAFTS
KGRFIAFLGRQSEPASRWLDELIYPVELFDRIGAVSAQVLDGNGRLRETGARFLVDGRLE
AITGSGNPNSPEFSHTRQIDAVSRSGLLIARSVWEQVGGFSEAFATDNQIDADLCLKVRA
AGLRICVAPLSSISILSASWAASEPLPFGDDNWFKRKWAGLLREAPSRTGNGIRRPDPDG
SRRVLFIDQQLPRIDIDAGSYAAIQEMRLFQALNFRVSFLPLNLLHLGAYTEALLRMGVE
ALHAPFCTSLEQALAARAGQFDVVYITRYNVAQSVIPLVRRYQPDTKIVFNVADLHFLRE
LRAGIAEKRDDQIRRSRLTRDAEFEVIRQVDLTLSYSDTEQAIILSHQLGDANVARVSWI
VEPTSDVPAFENRRDIAFLGSFGHRPNVEAVKFFAAEVLPVLRRRMPGIQVNIFGSQMSA
EVAELEQDGLVVHGHVEDLREVFDRARLFIAPLRSGAGIKGKVLAAMAAGIPTILSPIAV
EGIAAKPRTDFLLAESPAQWVDAIVDAYGNEKLWTSLSNSALNLVRDSYSFPEALHAMRA
ALERVDIFAPREGTALACRSVIPPLA

Enzyme Prediction     

No EC number prediction in MGYG000002310_04473.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13692	Glyco_trans_1_4	2.87e-18	913	1050	1	138	Glycosyl transferases group 1.
cd03801	GT4_PimA-like	1.55e-15	723	1085	1	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.64e-12	757	1085	38	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04186	GT_2_like_c	2.15e-08	530	669	63	158	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1215	BcsA	3.94e-08	457	669	47	258	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASF45580.1	5.62e-187	59	1097	61	1117
AXF84957.1	1.56e-184	56	1088	46	1091
ASM76987.1	3.51e-144	306	1096	146	964
ARE84861.1	1.78e-142	324	1090	309	1071
QEW23950.1	7.05e-142	345	1090	373	1120

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	6.28e-06	531	698	696	874	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002310_04473.