CAZyme Information: MGYG000002306_02031

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_02031
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		28645.75	4.5504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 692; End: 1495 Strand: -

Full Sequence      

MLPADADTPGGAQPRLASDPAQLGDDLVADERALRDPGTSEPALTAAAHREQAAYRAIAR
HPEWEAAARGRIPPELIDVYDRNVDARRQLTALTPVRNTLPAWRIEPPAPADELLGYYHQ
AEAESGVGWNYLAAINFIETRFGSIVGASTAGAQGPMQFLPSTFAGYGQGGDIHSPRDSI
LAAGRYLAANGFAADRDHAIYAYNHASEYVRAVDQYAALMAADPATFAAYYRWDVYCFTT
AGDVLLPIGYDASSPIPAADYVAAHPQ

Enzyme Prediction     

No EC number prediction in MGYG000002306_02031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	122	220	1.2e-17	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	1.41e-22	125	218	1	107	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.11e-07	132	204	4	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	4.04e-06	120	188	3	69	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00442	Lyz-like	2.28e-05	131	186	1	59	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
pfam13406	SLT_2	3.39e-05	120	191	79	200	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK52573.1	4.21e-193	1	267	33	299
QPM73668.1	4.21e-193	1	267	33	299
AZP83851.1	4.21e-193	1	267	33	299
AJK80597.1	7.03e-193	1	267	47	313
AGL38150.1	7.03e-193	1	267	47	313

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999983	0.000046	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_02031.