CAZyme Information: MGYG000002306_01665

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_01665
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		25128.23	5.5785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 1593; End: 2303 Strand: +

Full Sequence      

MRAAAVIGATAIVLASSCTWQLSLFIPDGVPPPAGDPVPPVDTHASGRPADQLRDWAAQR
AAGLEIPVIALEAYAYAARVAEVENPKCHIAWTTLAGIGQVESHHGTYRGARLAPNGDVS
PPIRGVRLDGSGGTLRIVDNDEDVTDEDGVTRAMGPMQFIPETWRLYAVDAHNDGRVSPD
NIDDAALAAAGYLCWRGKDLATPRGWITALRAYNNSGVYARAVRDWATAYAKGHPL

Enzyme Prediction     

No EC number prediction in MGYG000002306_01665.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	87	229	7.8e-19	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	2.05e-49	3	233	34	278	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	1.73e-24	88	229	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	7.40e-07	153	193	155	196	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd13402	LT_TF-like	4.52e-05	131	221	12	89	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	0.001	153	214	24	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAN30104.1	9.10e-174	1	236	1	236
APA74805.2	1.13e-173	1	236	7	242
AYQ71032.1	1.13e-173	1	236	7	242
ASF98394.1	1.13e-173	1	236	7	242
AZB40576.1	1.13e-173	1	236	7	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000105	0.999932	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_01665.