CAZyme Information: MGYG000002305_03162

Basic Information

• Species: Leminorella grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella grimontii
• CAZyme ID: MGYG000002305_03162
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000002305_14|CGC1	39316.78	5.8591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002305	4219592	Isolate	not provided	not provided

• Gene Location: Start: 36956; End: 37975 Strand: -

Full Sequence      

MSKTYFNEAEVIRTVMDFNHSEGGSENAFNIAYGIDKNFLFGCGVSIASVLLSNPSGHFV
FHVFTDYFSDDDRQKFDDLAAQYKTHISVYLIDCEKLKSLPSTKNWTYAIYFRFIIFDYF
ASRLDRILYLDADIVCQNSVDELLSLEFAGGACAVVAEGEAPWWKKRAEALRCTGIENGY
FNTGFLFVDLRAWQSQKITFQAIEMLQKAEVAQLVSFPDQDVLNMIFSGNVLFLDKKYNT
QFSLNYELKEKGSFVVPINEHTVFIHYIGPTKPWHNWAVYESAEPFFIAKSYSPWNEYPL
LKPTNSNLYRYCAKHQFNQKYIFPGLLSYVMYFITKLFY

Enzyme Prediction     

No EC number prediction in MGYG000002305_03162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	21	277	2.1e-59	0.9105058365758755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15171	PRK15171	1.07e-179	5	338	2	334	lipopolysaccharide 3-alpha-galactosyltransferase.
COG1442	RfaJ	1.20e-87	29	338	3	318	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	1.28e-80	30	278	1	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd04194	GT8_A4GalT_like	6.39e-75	29	276	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
cd02537	GT8_Glycogenin	4.01e-16	65	298	37	236	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APZ05079.1	7.55e-138	1	337	1	336
QAR44345.1	7.55e-138	1	337	1	336
AMG92623.1	2.95e-137	1	337	1	335
AUZ63968.1	4.19e-137	1	337	1	335
AUO66846.1	4.19e-137	1	337	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	6.18e-13	35	274	12	252	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19816	1.29e-134	1	337	1	335	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27128	3.08e-126	1	337	1	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19817	7.42e-71	18	338	15	334	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	8.70e-67	17	336	16	334	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
A0A0H2URH2	1.85e-15	92	297	64	251	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999904	0.000093	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002305_03162.