CAZyme Information: MGYG000002305_00999

Basic Information

• Species: Leminorella grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella grimontii
• CAZyme ID: MGYG000002305_00999
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000002305_2|CGC1	41328.8	5.487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002305	4219592	Isolate	not provided	not provided

• Gene Location: Start: 154087; End: 155211 Strand: -

Full Sequence      

MKSNAMKRAIVLLCSWLLVAQAWAAECDWPQWQSFKRDYVSQDGRVIDPADGKNITTSEG
QSYAMFFALVAGDRDAFGRLFAWTENNLSAGDLSARLPAWLWGKREDGSWGVLDDNSASD
ADLWIAYSLLEAGRLWHSRGYQVAGLRFLQRIVKDEVVNVPGLGTMLMPGRVGFIEAEKR
WRLNPSYLPPQLLTRLGRESRTLADVEATTQKMLLEAAPAGVAADWVVWSPEKGWLSDEK
TGATGDYDAIRVYLWLGTLADDAPHKRALMSHYQTMAKLTQEAGLPPETVDTQTGKGSGT
GPVGFSAALLPFLAGTPALSVQRERVLAHLPGSDAYYSSVLTLFGLGWEQQRYRFTSQGE
LLTSWERGSCKATD

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	29	348	2.2e-89	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	0.0	5	374	1	376	cellulase.
COG3405	BcsZ	2.30e-114	24	356	21	351	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.15e-72	27	350	2	320	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI34409.1	2.10e-230	10	372	1	363
QBH98347.1	1.14e-199	1	373	1	372
AWH90051.1	5.22e-196	10	371	1	361
AJI83001.1	8.79e-159	12	365	5	364
AJJ23032.1	8.79e-159	12	365	5	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	5.55e-140	27	365	2	339	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
3QXF_A	1.39e-135	27	365	2	339	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
7F81_A	5.65e-134	27	365	6	343	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	9.22e-133	27	365	6	343	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
4Q2B_A	6.11e-123	29	365	4	343	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8Z289	7.93e-143	25	365	22	361	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8ZLB7	1.12e-142	25	365	22	361	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8X5L9	6.23e-142	17	365	13	360	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	5.07e-141	4	365	2	360	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	1.34e-101	17	373	18	383	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.025619	0.969864	0.001887	0.000923	0.000610	0.001074

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002305_00999.