CAZyme Information: MGYG000002304_01560

Basic Information

• Species: UBA7182 sp003481535
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7182; UBA7182 sp003481535
• CAZyme ID: MGYG000002304_01560
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000002304_3|CGC4	34298.42	8.315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002304	3566085	Isolate	China	Asia

• Gene Location: Start: 236827; End: 237720 Strand: -

Full Sequence      

MQKVAAVVVTYNRKKLLCECLERLMKQEYPCDILVIDNASTDGTKESIDNFIQTGKIQYY
NTGSNLGGAGGFNFGMRLAVENGYEYVWIMDDDTYAEADALYQLMEADQKLQGNYGFLSG
VAYWTDGTLCNMNRQRISLRKKAEDFSSAVSPIIMATFVSFFVKSSVIREMGLPIKEFFI
WADDLEYSRRISKKYPCYLVPDSRVIHCMGSNQKVGIEQESKDRLWRYQYLYRNEVYVFR
REGLKGWFYLFARVGCHVAKILIKAKGDRTEKLKTIISSFISGFKFYPAIEYVDKES

Enzyme Prediction     

No EC number prediction in MGYG000002304_01560.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	110	3e-23	0.611764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	2.16e-78	6	238	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.74e-44	1	283	2	296	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	4.76e-27	7	207	2	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	7.50e-22	6	239	1	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	1.35e-20	7	107	3	102	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS04883.1	8.63e-104	2	293	4	295
QYA52275.1	8.63e-104	2	293	4	295
QDH97561.1	1.45e-103	1	297	1	300
AYC66889.1	1.45e-103	1	297	1	300
ADY85777.1	1.45e-103	1	297	1	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMX2	3.61e-16	2	253	3	276	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	3.61e-16	2	253	3	276	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
A0R5Z2	3.80e-14	4	253	7	279	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
A0A0H2UR96	1.44e-06	4	115	5	120	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q5HKQ0	1.92e-06	1	120	46	162	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002304_01560.