CAZyme Information: MGYG000002302_01298

Basic Information

• Species: Streptococcus vestibularis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus vestibularis
• CAZyme ID: MGYG000002302_01298
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193	MGYG000002302_16|CGC1	21733.84	9.5672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002302	1897565	Isolate	China	Asia

• Gene Location: Start: 7366; End: 7947 Strand: -

Full Sequence      

MRRRFKLTAFISLVALFALGILLPLILHASTDDNASSVKVAYTRQEFIETLAPIAQKMSK
NYGVPASILLSQAAYESNYGSSLLSVKYHNIYSLPAQPGQERIRLKDSIYSKGKWQYQKV
DFAVFKDWSSSMMTYLEELRQGTWGGSTYKEVAGTTSYKVAAEKLQATGFSSDPDYAKHL
ISIIETYHLSKYD

Enzyme Prediction     

No EC number prediction in MGYG000002302_01298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	189	9.5e-26	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.08e-43	1	193	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	7.15e-21	38	193	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	4.64e-17	29	193	303	472	amidase domain-containing protein.
PRK06347	PRK06347	7.93e-15	36	193	142	303	1,4-beta-N-acetylmuramoylhydrolase.
pfam01832	Glucosaminidase	3.39e-14	52	189	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY20374.1	1.78e-127	1	193	1	193
AMB81973.1	1.78e-127	1	193	1	193
CCB94493.1	1.78e-127	1	193	1	193
QKH70716.1	1.78e-127	1	193	1	193
ARI58045.1	1.78e-127	1	193	1	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	9.53e-15	27	193	12	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.62e-09	30	193	44	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.78e-09	45	184	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.05e-09	45	184	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	8.53e-08	45	185	4	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.91e-20	13	193	12	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	4.19e-13	45	193	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	1.64e-12	3	193	19	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
A2RHZ5	3.57e-12	32	193	49	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	3.57e-12	32	193	49	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.592809	0.394937	0.004937	0.001837	0.001236	0.004254

TMHMM  Annotations     

start	end
7	29