CAZyme Information: MGYG000002302_00357

Basic Information

• Species: Streptococcus vestibularis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus vestibularis
• CAZyme ID: MGYG000002302_00357
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		45195.24	3.9305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002302	1897565	Isolate	China	Asia

• Gene Location: Start: 48683; End: 50026 Strand: -

Full Sequence      

MLSKSKTTKALLYSTAALSLFAASHVHADEASNWTARSVDQIKADISVNDNQQTYTVQYG
DTLGSIAEAMGIDVNVLANINEITNIDLIFPGTVLTTTYNADNQTVSVKVETPVAATSNT
PVVAEANLTTNEVTVNDQSVVAADLSAPVETVSLTATQAPAKEESTQAVSEVTEAIASAS
EAPAYAETEQPVADAIDHVTSSAEETLAKEEAPATKTSAQAETTEVVAHPEAATSKAASE
APESSEAPSEQLVATSETASEAPSEQLAATSEAASAAPAASEAPASVAPVATSEAAPAAS
EAPASVAPVATSEAAPAASEAPAPAAETHKVSAASTPNTYPVGQCTWGAKSLAPWAGNNW
GNAKDWIASAQAAGHSVGTTPVAGAIAVWPNDGGGYGHVAYVTSASGVNSIQVMESNYAG
NMLIGNYRGIFDPTSSAHGGSVFYIYP

Enzyme Prediction     

No EC number prediction in MGYG000002302_00357.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	2.22e-23	330	447	58	172	Surface antigen [Cell wall/membrane/envelope biogenesis].
pfam05257	CHAP	5.67e-18	336	417	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
cd00118	LysM	3.57e-11	53	96	1	44	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.53e-10	54	96	1	43	Lysin motif.
PRK10811	rne	2.88e-10	101	266	851	1009	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXN96970.1	3.79e-187	1	447	1	465
CAD0193584.1	6.62e-175	1	447	1	482
CAD0133931.1	6.62e-175	1	447	1	482
CAD0128058.1	6.62e-175	1	447	1	482
CAD0136461.1	6.62e-175	1	447	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CGK_A	2.60e-32	334	446	281	390	Crystalstructure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39],4CGK_B Crystal structure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39]
2LRJ_A	3.53e-13	332	446	3	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DVU8	1.41e-34	338	447	103	210	Putative hydrolase SMU_367 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=SMU_367 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000291	0.998970	0.000214	0.000188	0.000178	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002302_00357.