CAZyme Information: MGYG000002300_01554

Basic Information

• Species: Bacteroides cutis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cutis
• CAZyme ID: MGYG000002300_01554
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000002300_3|CGC4	48791.9	4.8724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002300	3878569	Isolate	China	Asia

• Gene Location: Start: 273142; End: 274431 Strand: +

Full Sequence      

MKKILLFCCAITTLQSFYSCTSTQSKEDYTWLKNAIDVSAEQLKGTVTDVGDSLLLPRSI
WTGYDMDFLCSQLQRDPATFKDSLRVKPVKDVIGTRRYCSSVYDWTSGFFPGNLWYAYQI
TGDEDLKKDAIKFTNYLYPVREYKGTHDIGFMMNCSYGNAYRLCPADSVRQALIQTADNL
CERFDPQIGCIRSWDFGKWNFPVIIDNMMNLDLLFYVSNLTNNPEYKEIALKHADTTLKN
HFREDHSSYHVVSYNNDGTVELKCTHQGKNDDSSWARGQAWGVYGYTSCYRESKDEVFLQ
QAKDIANLIMTRVKTEDAVPLWDYDAPDTPQTPRDASAASITASALIELSTLVEDGQVYL
DYAEKLLKSLSSDAYLAKSGSNQGFILMHSTGSLPNGSEIDTPINYADYYYLEALVRYMQ
VKGLDYKSL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	102	418	2.2e-122	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16386	DUF4995	3.07e-30	1	75	1	73	Domain of unknown function. This family around 100 residues locates in the N-terminal of some uncharacterized proteins and glucuronyl hydrolases in various Bacteroides species. The function of this family remains unknown.
pfam07470	Glyco_hydro_88	2.75e-11	104	323	28	240	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67525.1	3.51e-291	1	429	1	429
ALJ58956.1	1.17e-289	1	429	1	429
QUT89927.1	1.17e-289	1	429	1	429
ADV43618.1	3.92e-288	1	429	1	429
AVM58832.1	1.81e-277	1	429	1	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.55e-126	104	429	72	399	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	1.98e-49	104	417	41	363	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	1.06e-48	104	417	41	363	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	1.78e-46	104	418	67	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.82e-46	104	418	68	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.14e-93	104	417	76	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	1.09e-48	104	417	41	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8E372	9.97e-46	104	418	68	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.33e-45	104	418	66	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	7.49e-45	66	418	34	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000723	0.168023	0.831030	0.000073	0.000081	0.000084

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002300_01554.